LOCUS       XM_005172495             719 bp    mRNA    linear   VRT 08-SEP-2024
DEFINITION  PREDICTED: Danio rerio ring finger protein 122 (rnf122), transcript
            variant X1, mRNA.
ACCESSION   XM_005172495
VERSION     XM_005172495.5
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007119.7) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 8, 2024 this sequence version replaced XM_005172495.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000002035.6-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/15/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..719
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="8"
     gene            1..719
                     /gene="rnf122"
                     /gene_synonym="si:ch1073-392o20.1"
                     /note="ring finger protein 122; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 103 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100329730"
                     /db_xref="ZFIN:ZDB-GENE-091204-454"
     CDS             127..591
                     /gene="rnf122"
                     /gene_synonym="si:ch1073-392o20.1"
                     /codon_start=1
                     /product="RING finger protein 122 isoform X1"
                     /protein_id="XP_005172552.1"
                     /db_xref="GeneID:100329730"
                     /db_xref="ZFIN:ZDB-GENE-091204-454"
                     /translation="

MHPFQWCNGCFCGLGLIYSNKTCTMPSVTFQDLPLNIYMVIFGTGIFVFVLSLIFCCYFISKLRHQAQSERFGYREVVLKGDPKKLNLHGTCAVCLEDFKVKDELGVLPCQHAFHRRCVVKWLEVRCVCPMCNKPLSGSSEQHQSLGTLLDELV"

     misc_feature    397..534
                     /gene="rnf122"
                     /gene_synonym="si:ch1073-392o20.1"
                     /note="RING finger (Really Interesting New Gene) domain
                     and U-box domain superfamily; Region: RING_Ubox; cl17238"
                     /db_xref="CDD:473075"
     misc_feature    order(400..402,409..411,454..456,460..462,469..471,
                     478..480,511..513,520..522)
                     /gene="rnf122"
                     /gene_synonym="si:ch1073-392o20.1"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:438111"
ORIGIN      

gtgattgtgttttgggtgaatccagatgtgatgtatggcctgacagagagacagacaggcggagggcatcgtctctgtttataaacacacggatcttcatataggaatcagatatatgggggattaatgcaccctttccagtggtgcaacgggtgcttctgcggtttgggactaatctactccaataagacctgcactatgccctccgtcaccttccaggaccttcctctcaacatctacatggtcatcttcggcacaggcatcttcgtcttcgtcctcagcctcatcttctgctgctacttcataagtaaattgagacatcaggctcaaagtgaacgctttggataccgagaggtggttttaaaaggggatccaaagaagctgaatctacatgggacgtgtgcagtgtgtctggaggactttaaggtgaaagatgagctgggagtgttgccatgccaacatgcctttcacaggaggtgtgtggtgaagtggctggaggtgcgctgtgtgtgtccaatgtgtaacaaacctctgtctggatcctccgagcagcaccagagcctcgggactctgctggatgagctggtgtagagcgcagactagcattagcatcaaaaaaaacaaaaaaactcacaaacgcctctgacctgactgtgatttcacccgaatctgagactgatgaacgccagggccacgtcttattcatgacgaaccaactg

//