GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 10:02:28, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_205690               1382 bp    mRNA    linear   VRT 25-AUG-2024
DEFINITION  Danio rerio retinaldehyde binding protein 1b (rlbp1b), mRNA.
ACCESSION   NM_205690
VERSION     NM_205690.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1382)
  AUTHORS   Ulhaq,Z.S., Okamoto,K., Ogino,Y. and Tse,W.K.F.
  TITLE     Dysregulation of Spliceosomes Complex Induces Retinitis
            Pigmentosa-Like Characteristics in sf3b4-Depleted Zebrafish
  JOURNAL   Am J Pathol 193 (9), 1223-1233 (2023)
   PUBMED   37263342
REFERENCE   2  (bases 1 to 1382)
  AUTHORS   Chen,D.D., Liu,B., Wang,Y., Jiang,M., Shang,G., Xue,M., Jia,X.,
            Lang,Y., Zhou,G., Zhang,F., Peng,X. and Hu,Y.
  TITLE     The downregulation of HSP90-controlled CRALBP expression is
            associated with age-related vision attenuation
  JOURNAL   FASEB J 37 (3), e22832 (2023)
   PUBMED   36826429
REFERENCE   3  (bases 1 to 1382)
  AUTHORS   Schlegel,D.K., Ramkumar,S., von Lintig,J. and Neuhauss,S.C.
  TITLE     Disturbed retinoid metabolism upon loss of rlbp1a impairs cone
            function and leads to subretinal lipid deposits and photoreceptor
            degeneration in the zebrafish retina
  JOURNAL   Elife 10, e71473 (2021)
   PUBMED   34668483
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1382)
  AUTHORS   Ward,R., Kaylor,J.J., Cobice,D.F., Pepe,D.A., McGarrigle,E.M.,
            Brockerhoff,S.E., Hurley,J.B., Travis,G.H. and Kennedy,B.N.
  TITLE     Non-photopic and photopic visual cycles differentially regulate
            immediate, early, and late phases of cone photoreceptor-mediated
            vision
  JOURNAL   J Biol Chem 295 (19), 6482-6497 (2020)
   PUBMED   32238432
REFERENCE   5  (bases 1 to 1382)
  AUTHORS   Ranski,A.H., Kramer,A.C., Morgan,G.W., Perez,J.L. and Thummel,R.
  TITLE     Characterization of retinal regeneration in adult zebrafish
            following multiple rounds of phototoxic lesion
  JOURNAL   PeerJ 6, e5646 (2018)
   PUBMED   30258730
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1382)
  AUTHORS   Thomas,J.L., Ranski,A.H., Morgan,G.W. and Thummel,R.
  TITLE     Reactive gliosis in the adult zebrafish retina
  JOURNAL   Exp Eye Res 143, 98-109 (2016)
   PUBMED   26492821
REFERENCE   7  (bases 1 to 1382)
  AUTHORS   Konzer,A., Ruhs,A., Braun,H., Jungblut,B., Braun,T. and Kruger,M.
  TITLE     Stable isotope labeling in zebrafish allows in vivo monitoring of
            cardiac morphogenesis
  JOURNAL   Mol Cell Proteomics 12 (6), 1502-1512 (2013)
   PUBMED   23412571
REFERENCE   8  (bases 1 to 1382)
  AUTHORS   Veneman,W.J., Stockhammer,O.W., de Boer,L., Zaat,S.A., Meijer,A.H.
            and Spaink,H.P.
  TITLE     A zebrafish high throughput screening system used for
            Staphylococcus epidermidis infection marker discovery
  JOURNAL   BMC Genomics 14, 255 (2013)
   PUBMED   23586901
  REMARK    Publication Status: Online-Only
REFERENCE   9  (bases 1 to 1382)
  AUTHORS   Collery,R., McLoughlin,S., Vendrell,V., Finnegan,J., Crabb,J.W.,
            Saari,J.C. and Kennedy,B.N.
  TITLE     Duplication and divergence of zebrafish CRALBP genes uncovers novel
            role for RPE- and Muller-CRALBP in cone vision
  JOURNAL   Invest Ophthalmol Vis Sci 49 (9), 3812-3820 (2008)
   PUBMED   18502992
REFERENCE   10 (bases 1 to 1382)
  AUTHORS   Fleisch,V.C., Schonthaler,H.B., von Lintig,J. and Neuhauss,S.C.
  TITLE     Subfunctionalization of a retinoid-binding protein provides
            evidence for two parallel visual cycles in the cone-dominant
            zebrafish retina
  JOURNAL   J Neurosci 28 (33), 8208-8216 (2008)
   PUBMED   18701683
  REMARK    GeneRIF: Cralbp b expression in Muller cells of the retina is
            essential for cone vision and provides evidence that both the
            canonical and the alternative visual cycle depend on the same type
            of retinoid-binding protein.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC065863.1.
            
            On Aug 30, 2012 this sequence version replaced NM_205690.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC065863.1, EU348854.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505371, SAMEA3505372
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1382              BC065863.1         5-1386
FEATURES             Location/Qualifiers
     source          1..1382
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="25"
                     /map="25"
     gene            1..1382
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /note="retinaldehyde binding protein 1b"
                     /db_xref="GeneID:402990"
                     /db_xref="ZFIN:ZDB-GENE-040426-1870"
     exon            1..42
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    16..18
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /note="upstream in-frame stop codon"
     CDS             31..954
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /note="cralbpa; rlbp1a; retinaldehyde binding protein 1"
                     /codon_start=1
                     /product="retinaldehyde-binding protein 1b"
                     /protein_id="NP_991253.1"
                     /db_xref="GeneID:402990"
                     /db_xref="ZFIN:ZDB-GENE-040426-1870"
                     /translation="
MAVVSGTFRMVSEEEQALRAKLEHLTVKDHGPVFEASTKVPDHTMQKAKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFRRDYPELFENLTPEAVRSTIEAGYPGILSSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEILPSDFDGKGSKYDGKITAAHLFD"
     misc_feature    208..381
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /note="CRAL/TRIO, N-terminal domain; Region: CRAL_TRIO_N;
                     smart01100"
                     /db_xref="CDD:215024"
     misc_feature    451..906
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /note="Sec14p-like lipid-binding domain; Region: SEC14;
                     cd00170"
                     /db_xref="CDD:469559"
     exon            43..171
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
     exon            172..376
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
     exon            377..555
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
     exon            556..714
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
     exon            715..825
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
     exon            826..1356
                     /gene="rlbp1b"
                     /gene_synonym="CRALBPb; rlbp1; zgc:77766"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cacagaacgttgcattgagtatttgaagcaatggcggttgttagtggaacatttcgaatggtgtccgaggaggagcaggcccttcgggcgaagctggagcacctcacggtcaaagaccatgggcccgtgtttgaagcctctacaaaagtaccagaccacaccatgcagaaggctaaagatgagctgaatgagacggatgagaagcgaacgtcagctgtgaaggagctcagaggaataatcaaggagaaggcagagactggagatgagcttgctaaaggtgttcaggatacttttggggaaaaacccgatggcgtgcttgtgaggttcatccgtgccaggaaatatgatgtaaaccgggcctatgaactcatgaagggttatgtgcgcttcagacgggattatcctgaactttttgaaaacttgactccggaggctgtgcgcagcaccattgaggccggatacccaggaatcctatccagcagagacaaatatggccgcgtggtgctactctttaacatcgagaactgggactatgaggagatcacttttgatgagatccttagagcttactgtgtgatcctggagaagcttctggaaaatgaggagactcagatcaacggcttttgcatcatcgagaactttaagggtttcacaatgcagcaagcctccggcatcaagcccacagagctaaagaaaatggtggacatgttgcaggactctttccctgcccgtttcaaagcagtgcactttatccaccagccctggtacttcaccaccacatacaatgtggtcaaacccctgatgaagagcaaactgctggaaagggtgtttgtccacggtgatgacctggaaaactacttcaaggagtttgatgctgaaatcctgccatcagactttgatggtaaaggctccaaatatgacggcaagatcacagcagcacatctgtttgactaggccattttcagcctgtcactgtacaagaacacgactgtcgttttagttgcattgtatcacatggcattccaatgtgtttattttcctgagggtgaacccagaagtatagagattttcccaagcgaaactggataagtctccagacgccatcaaagagggatgaaaacagatacgatcagttagttctctatgagggccgtgtatttagattttccctgaaatatagatattcttcagcaacagatggcagatgacaaagtccaggcattcctgttctttgtctttttaactgagaacggaaaagcactcagcctggtctaagtgttacaagcaaactatatatgatgttcagaatgtgtagaatgtttctgtttctctaaataaagtgcacatttcaaatgaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]