2024-05-05 02:56:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_180964 755 bp mRNA linear VRT 12-NOV-2023 DEFINITION Danio rerio claudin d (cldnd), mRNA. ACCESSION NM_180964 VERSION NM_180964.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 755) AUTHORS Rostam N, Goloborodko A, Riemer S, Hertel A, Riedel D, Vorbruggen G and Dosch R. TITLE The germ plasm is anchored at the cleavage furrows through interaction with tight junctions in the early zebrafish embryo JOURNAL Development 149 (15) (2022) PUBMED 35735123 REFERENCE 2 (bases 1 to 755) AUTHORS Solis CJ, Hamilton MK, Caruffo M, Garcia-Lopez JP, Navarrete P, Guillemin K and Feijoo CG. TITLE Intestinal Inflammation Induced by Soybean Meal Ingestion Increases Intestinal Permeability and Neutrophil Turnover Independently of Microbiota in Zebrafish JOURNAL Front Immunol 11, 1330 (2020) PUBMED 32793187 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 755) AUTHORS Schwayer C, Shamipour S, Pranjic-Ferscha K, Schauer A, Balda M, Tada M, Matter K and Heisenberg CP. TITLE Mechanosensation of Tight Junctions Depends on ZO-1 Phase Separation and Flow JOURNAL Cell 179 (4), 937-952 (2019) PUBMED 31675500 REFERENCE 4 (bases 1 to 755) AUTHORS Hou J, Liu H, Zhang S, Liu X, Hayat T, Alsaedi A and Wang X. TITLE Mechanism of toxic effects of Nano-ZnO on cell cycle of zebrafish (Danio rerio) JOURNAL Chemosphere 229, 206-213 (2019) PUBMED 31078877 REFERENCE 5 (bases 1 to 755) AUTHORS Sun J, Yan L, Shen W and Meng A. TITLE Maternal Ybx1 safeguards zebrafish oocyte maturation and maternal-to-zygotic transition by repressing global translation JOURNAL Development 145 (19) (2018) PUBMED 30135188 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 755) AUTHORS Clelland ES and Kelly SP. TITLE Exogenous GDF9 but not Activin A, BMP15 or TGFbeta alters tight junction protein transcript abundance in zebrafish ovarian follicles JOURNAL Gen Comp Endocrinol 171 (2), 211-217 (2011) PUBMED 21291886 REFERENCE 7 (bases 1 to 755) AUTHORS Clelland ES and Kelly SP. TITLE Tight junction proteins in zebrafish ovarian follicles: stage specific mRNA abundance and response to 17beta-estradiol, human chorionic gonadotropin, and maturation inducing hormone JOURNAL Gen Comp Endocrinol 168 (3), 388-400 (2010) PUBMED 20553723 REFERENCE 8 (bases 1 to 755) AUTHORS Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B. TITLE Extensive expansion of the claudin gene family in the teleost fish, Fugu rubripes JOURNAL Genome Res 14 (7), 1248-1257 (2004) PUBMED 15197168 REFERENCE 9 (bases 1 to 755) AUTHORS Li Y, Chia JM, Bartfai R, Christoffels A, Yue GH, Ding K, Ho MY, Hill JA, Stupka E and Orban L. TITLE Comparative analysis of the testis and ovary transcriptomes in zebrafish by combining experimental and computational tools JOURNAL Comp Funct Genomics 5 (5), 403-418 (2004) PUBMED 18629171 REFERENCE 10 (bases 1 to 755) AUTHORS Gong Z, Yan T, Liao J, Lee SE, He J and Hew CL. TITLE Rapid identification and isolation of zebrafish cDNA clones JOURNAL Gene 201 (1-2), 87-98 (1997) PUBMED 9409775 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AJ011789.1. On Jun 3, 2003 this sequence version replaced NM_180964.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AJ011789.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..755 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="21" /map="21" gene 1..755 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /note="claudin d" /db_xref="GeneID:81583" /db_xref="ZFIN:ZDB-GENE-010328-4" exon 1..755 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /inference="alignment:Splign:2.1.0" CDS 11..637 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="NP_851295.1" /db_xref="GeneID:81583" /db_xref="ZFIN:ZDB-GENE-010328-4" /translation="
MASVGLQLLATVLAIIGWLGEIVICALPMWKVTAFIGNNIVTAQIFWEGLWMNCVQQSTGQMQCKVYDSMLALPQDLQAARALVVISIIVTFMGVFLTIAGGKCTNCIEDQDAKAKVVVAAGVFFLVGGILCLIPVCWSANSVIKDFYNPTLSDAQKRELGASLFIGWCASGLLLLGGALLCCQCPKNEGRAYSVKYSAPRSAPGAYV"
misc_feature 23..520 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 32..94 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1); transmembrane region" misc_feature 254..316 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1); transmembrane region" misc_feature 359..421 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1); transmembrane region" misc_feature 488..550 /gene="cldnd" /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004" /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1); transmembrane region" ORIGIN
aaaatctacaatggcatctgttgggcttcagcttctggccactgtcctggcgatcatcggctggttgggtgaaatcgtcatttgcgcgctgcccatgtggaaggtgacggctttcattggcaacaacatcgtgaccgcgcagattttctgggaaggcctctggatgaactgtgtgcagcaaagcacaggtcagatgcagtgcaaggtttatgactccatgctggctctacctcaagacctccaggccgcccgagctctcgtggtcatctccataatcgtcactttcatgggcgttttcctgaccatcgctggaggaaagtgcaccaactgcattgaggaccaggacgcgaaggctaaagtcgtggtcgccgctggagtgttcttcctggttggtggaattctttgtttgatcccggtgtgctggtccgcgaactccgtcatcaaggatttctacaaccccaccctgtccgatgctcagaaacgggagctgggagcgtcactcttcatcggctggtgcgcgtccggtctgctgctgctcggcggagcactgctctgctgccagtgcccgaagaacgagggtcgcgcttattctgttaagtactctgctcccaggtctgctccaggagcttatgtgtgacgcaccgactttctggactagtgttatcgtctcctgtttgtgtaggaagagatttttatgttttactttctggtcttgcatgaccgtttttaatttaataaacgtcttaatgattttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]