LOCUS       NM_178132               1357 bp    mRNA    linear   VRT 11-SEP-2023
DEFINITION  Danio rerio NK3 homeobox 2 (nkx3-2), mRNA.
ACCESSION   NM_178132
VERSION     NM_178132.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1357)
  AUTHORS   Watson CJ, Tang WJ, Rojas MF, Fiedler IAK, Morfin Montes de Oca E,
            Cronrath AR, Callies LK, Swearer AA, Ahmed AR, Sethuraman V, Addish
            S, Farr GH 3rd, Gomez AE, Rai J, Monstad-Rios AT, Gardiner EM,
            Karasik D, Maves L, Busse B, Hsu YH and Kwon RY.
  TITLE     wnt16 regulates spine and muscle morphogenesis through parallel
            signals from notochord and dermomyotome
  JOURNAL   PLoS Genet 18 (11), e1010496 (2022)
   PUBMED   36346812
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1357)
  AUTHORS   Waldmann L, Leyhr J, Zhang H, Ohman-Magi C, Allalou A and Haitina
            T.
  TITLE     The broad role of Nkx3.2 in the development of the zebrafish axial
            skeleton
  JOURNAL   PLoS One 16 (8), e0255953 (2021)
   PUBMED   34411150
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1357)
  AUTHORS   Castellanos BS, Reyes-Nava NG and Quintana AM.
  TITLE     Knockdown of hspg2 is associated with abnormal mandibular joint
            formation and neural crest cell dysfunction in zebrafish
  JOURNAL   BMC Dev Biol 21 (1), 7 (2021)
   PUBMED   33678174
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1357)
  AUTHORS   Smeeton J, Natarajan N, Naveen Kumar A, Miyashita T, Baddam P,
            Fabian P, Graf D and Crump JG.
  TITLE     Zebrafish model for spondylo-megaepiphyseal-metaphyseal dysplasia
            reveals post-embryonic roles of Nkx3.2 in the skeleton
  JOURNAL   Development 148 (2) (2021)
   PUBMED   33462117
  REMARK    GeneRIF: Zebrafish model for spondylo-megaepiphyseal-metaphyseal
            dysplasia reveals post-embryonic roles of Nkx3.2 in the skeleton.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1357)
  AUTHORS   Gebuijs IGE, Metz JR, Zethof J, Carels CEL, Wagener FADTG and Von
            den Hoff JW.
  TITLE     The anti-epileptic drug valproic acid causes malformations in the
            developing craniofacial skeleton of zebrafish larvae
  JOURNAL   Mech Dev 163, 103632 (2020)
   PUBMED   32668265
REFERENCE   6  (bases 1 to 1357)
  AUTHORS   Walker MB, Miller CT, Coffin Talbot J, Stock DW and Kimmel CB.
  TITLE     Zebrafish furin mutants reveal intricacies in regulating
            Endothelin1 signaling in craniofacial patterning
  JOURNAL   Dev Biol 295 (1), 194-205 (2006)
   PUBMED   16678149
REFERENCE   7  (bases 1 to 1357)
  AUTHORS   Nissen RM, Amsterdam A and Hopkins N.
  TITLE     A zebrafish screen for craniofacial mutants identifies wdr68 as a
            highly conserved gene required for endothelin-1 expression
  JOURNAL   BMC Dev Biol 6, 28 (2006)
   PUBMED   16759393
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 1357)
  AUTHORS   Woods IG, Wilson C, Friedlander B, Chang P, Reyes DK, Nix R, Kelly
            PD, Chu F, Postlethwait JH and Talbot WS.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   9  (bases 1 to 1357)
  AUTHORS   Clouthier DE and Schilling TF.
  TITLE     Understanding endothelin-1 function during craniofacial development
            in the mouse and zebrafish
  JOURNAL   Birth Defects Res C Embryo Today 72 (2), 190-199 (2004)
   PUBMED   15269892
  REMARK    Review article
REFERENCE   10 (bases 1 to 1357)
  AUTHORS   Miller CT, Maves L and Kimmel CB.
  TITLE     moz regulates Hox expression and pharyngeal segmental identity in
            zebrafish
  JOURNAL   Development 131 (10), 2443-2461 (2004)
   PUBMED   15128673
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY225416.1.
            
            On Jun 3, 2003 this sequence version replaced NM_178132.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY225416.1, BC162299.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505380
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1357
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="14"
                     /map="14"
     gene            1..1357
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="NK3 homeobox 2"
                     /db_xref="GeneID:337865"
                     /db_xref="ZFIN:ZDB-GENE-030127-1"
     misc_feature    105..107
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="upstream in-frame stop codon"
     CDS             123..860
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="bagpipe homeobox homolog 1"
                     /codon_start=1
                     /product="homeobox protein Nkx-3.2"
                     /protein_id="NP_835233.1"
                     /db_xref="GeneID:337865"
                     /db_xref="ZFIN:ZDB-GENE-030127-1"
                     /translation="

MAVRSNSLMPFSIQAILNRKEESRHLNELDVCFSKSACWKIFDEMDAPERSDETEHKNYDSDSGLSEDNDAKAQIDAKPEKDADLADETDQESAAKGLSDCVSDCNTAEEKSGDAPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDRRQYSPGELLRPPLLSLQPSYYYPYTYCLPAWSLSSACSGNQ"

     misc_feature    315..>653
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="Homeodomain-containing transcription factor
                     [Transcription]; Region: COG5576"
                     /db_xref="CDD:227863"
     misc_feature    order(483..497,501..503,552..554,570..572,609..611,
                     615..620,627..632,636..644,648..653)
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    489..650
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(489..491,498..500,618..620,627..632,639..641)
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      

gcacgagaccaaactccctttacgcgcggcgcgatgcgaccgaactgcggccacggagctcgatggaccgcgtaatcttaaccctaatgctccgcgacccggtctgactagtgctgctcgacatggctgtgcgcagtaactctctgatgccattctcaattcaagccattctgaaccgaaaagaggagtctcgccatctgaacgagctggatgtgtgtttctcaaagagcgcgtgctggaaaatattcgatgaaatggacgcaccggagcggagcgacgaaacggagcataagaactacgattccgactccgggctgagcgaggacaacgacgctaaagcgcaaatcgacgcaaagccagaaaaagacgcagatttagcggacgagacggatcaggaatccgcggccaagggcctgagcgactgcgtgtccgactgtaacacggccgaggagaagagcggcgatgcgccgaagcagcggaagaagcgctcccgggccgcgttctcccacgcgcaggtgttcgagctcgagcgccgcttcaaccaccagcgttatctctccggaccggagcgcgcagacctcgcggcctccctcaaactcaccgagacgcaggtcaagatctggttccagaatcgacggtacaaaaccaagcgacgtcagatggccgccgatctgctggcgtcagccccggcggcgaagaaagtggcggtgaaggtgctggtccgggacgaccgacggcagtacagccccggggagttgctgcgaccgccgcttctgtcgctgcagccctcttattattacccgtacacgtactgcctgcccgcctggagcctgtcctccgcctgctctggaaaccagtgacaccaggactctccgacccatatttattacgcgaaagactttcgtttaccgaacacgccgagtgagcaaccaaaaccgggagatgttattcagtggaactgtcttcaccgaaacagactcgttatctccaggactgctgatgtgctcctgattaactctattaggattctatctcagaatgtgtggaaatgtgtcattcccggctcgtgttttagcgaaatgttcgttcttctggttggaaaacaaagcagcacttgatgccgttactgccgttcggttttagggtataaacggtaagactggcactttccccctccacagttccacatgttaaaatcagaagaaaatattgaacatttgctggacttgaggagccgtgaaggctcgcccgtttactagacatgtacttgttttcatattggtgtatcgtgttttgtttaatgaaaaagaaatgaagcattaaaaggtatgaagaataaaaaaaaaaaaaaaaaaaa

//