LOCUS       NM_131769               1681 bp    mRNA    linear   VRT 08-OCT-2023
DEFINITION  Danio rerio claudin j (cldnj), mRNA.
ACCESSION   NM_131769
VERSION     NM_131769.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1681)
  AUTHORS   Lu J, Liu R, Miao A, Chen X, Xiao W, Wang Y, Cao D, Pan J, Li L and
            Luo Y.
  TITLE     The role of cldnh during the early retinal development in zebrafish
  JOURNAL   Exp Eye Res 200, 108207 (2020)
   PUBMED   32866532
  REMARK    GeneRIF: The role of cldnh during the early retinal development in
            zebrafish.
REFERENCE   2  (bases 1 to 1681)
  AUTHORS   Conant GC.
  TITLE     The lasting after-effects of an ancient polyploidy on the genomes
            of teleosts
  JOURNAL   PLoS One 15 (4), e0231356 (2020)
   PUBMED   32298330
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1681)
  AUTHORS   Li X, Song G, Zhao Y, Zhao F, Liu C, Liu D, Li Q and Cui Z.
  TITLE     Claudin7b is required for the formation and function of inner ear
            in zebrafish
  JOURNAL   J Cell Physiol 233 (4), 3195-3206 (2018)
   PUBMED   28834538
REFERENCE   4  (bases 1 to 1681)
  AUTHORS   Shu Y, Lou Q, Dai Z, Dai X, He J, Hu W and Yin Z.
  TITLE     The basal function of teleost prolactin as a key regulator on ion
            uptake identified with zebrafish knockout models
  JOURNAL   Sci Rep 6, 18597 (2016)
   PUBMED   26726070
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1681)
  AUTHORS   Baltzegar DA, Reading BJ, Brune ES and Borski RJ.
  TITLE     Phylogenetic revision of the claudin gene family
  JOURNAL   Mar Genomics 11, 17-26 (2013)
   PUBMED   23726886
REFERENCE   6  (bases 1 to 1681)
  AUTHORS   Kumai Y, Bahubeshi A, Steele S and Perry SF.
  TITLE     Strategies for maintaining Na balance in zebrafish (Danio rerio)
            during prolonged exposure to acidic water
  JOURNAL   Comp Biochem Physiol A Mol Integr Physiol 160 (1), 52-62 (2011)
   PUBMED   21600298
REFERENCE   7  (bases 1 to 1681)
  AUTHORS   Han Y, Mu Y, Li X, Xu P, Tong J, Liu Z, Ma T, Zeng G, Yang S, Du J
            and Meng A.
  TITLE     Grhl2 deficiency impairs otic development and hearing ability in a
            zebrafish model of the progressive dominant hearing loss DFNA28
  JOURNAL   Hum Mol Genet 20 (16), 3213-3226 (2011)
   PUBMED   21610158
REFERENCE   8  (bases 1 to 1681)
  AUTHORS   Clelland ES and Kelly SP.
  TITLE     Tight junction proteins in zebrafish ovarian follicles: stage
            specific mRNA abundance and response to 17beta-estradiol, human
            chorionic gonadotropin, and maturation inducing hormone
  JOURNAL   Gen Comp Endocrinol 168 (3), 388-400 (2010)
   PUBMED   20553723
REFERENCE   9  (bases 1 to 1681)
  AUTHORS   Hardison AL, Lichten L, Banerjee-Basu S, Becker TS and Burgess SM.
  TITLE     The zebrafish gene claudinj is essential for normal ear function
            and important for the formation of the otoliths
  JOURNAL   Mech Dev 122 (7-8), 949-958 (2005)
   PUBMED   15925497
  REMARK    GeneRIF: Morpholino inhibition of claudinj expression showed
            similar defects in otolith formation.
REFERENCE   10 (bases 1 to 1681)
  AUTHORS   Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CR382327.27.
            
            On May 31, 2017 this sequence version replaced NM_131769.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1681              CR382327.27        102963-104643
FEATURES             Location/Qualifiers
     source          1..1681
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="15"
                     /map="15"
     gene            1..1681
                     /gene="cldnj"
                     /gene_synonym="cldn8l; fc30g01; wu:fc30g01"
                     /note="claudin j"
                     /db_xref="GeneID:81589"
                     /db_xref="ZFIN:ZDB-GENE-010328-10"
     exon            1..1681
                     /gene="cldnj"
                     /gene_synonym="cldn8l; fc30g01; wu:fc30g01"
                     /inference="alignment:Splign:2.1.0"
     CDS             34..666
                     /gene="cldnj"
                     /gene_synonym="cldn8l; fc30g01; wu:fc30g01"
                     /codon_start=1
                     /product="claudin j"
                     /protein_id="NP_571844.2"
                     /db_xref="GeneID:81589"
                     /db_xref="ZFIN:ZDB-GENE-010328-10"
                     /translation="

MALQVLGITLSMIGFAGTIIICALPMWKVTAFIGTNIVVAQVFWEGLWMTCVYERIGQMQCKLYDALLDLDPFLQASRGLIVTTMALASLAFLIFLIGADCTNCLSNPRAKGRIVVVSGITFMLSGLTTVVPVSWTADSIIRDFHNPVVHEALKREMGAALYVGWLTAGFLFIGGAILCTSCPPERDNYLPRYTLTKSGTHSGYAVKNYV"

     misc_feature    34..567
                     /gene="cldnj"
                     /gene_synonym="cldn8l; fc30g01; wu:fc30g01"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      

ttcttgtctctgtggtctccagcccgctcctccatggctctgcaggttttgggaatcactctgtcaatgatcggctttgcgggaaccatcatcatctgcgcgctgcccatgtggaaggtgaccgccttcattggcaccaacatcgtggtggctcaggtgttttgggaaggcctgtggatgacctgtgtgtatgagcgcatcggccagatgcagtgcaaactctatgacgccctgctggatttggaccccttcctgcaggcgtcccgcgggctcatagtgaccaccatggctttggccagcttggctttcctcatttttctgattggggctgattgcactaactgtctgagtaacccacgggccaaaggacggattgtggtggtctccggcatcacctttatgctttcaggactgaccactgtggtgcccgtgtcctggacagccgactccattataagggactttcacaatcctgtagtgcacgaggctttaaagagggagatgggagcagctctttatgtgggctggttaacagccgggtttctgtttattggtggagcaattctgtgcaccagttgcccaccggagcgggacaactatttaccacggtatactttaacaaaatctggcactcacagtggctatgctgtaaagaactatgtctgacaggtaacactctctaaaatagtagactgaacaaaaattattggatttcctagtttttttttagggtaaactattcatttgggctgaatttaaacaaaaaaggtgattttagtaatcaacttaatttgagtgcgtttatattcagctcgtatgaattgtttgcaaccatttaccctaaaaaatgtagtaaatccaatgaatatttttttgtgtgtattgcacaagtgttatgctgcatccacaccagacgcggaacgcgattcaagcgtgagtgatttacatgttaagtcaatgcaaacacgcaaatagacatcctgcgaatggcgcgacgcaaattgaacgttttgcgcgttaaacaaccaggagcttgcacttgtggaggtgtgattgtgacgtatcccctgttgtcggtgttccgggggaaatccttcagccgaaaccgacaaaaagttcatcaaactgtgctcagcgcagtcagaagcaccgctgaaagcctccatcagccaggttaagtttctggaggagtttatgagctcacagagctggatgcacatctgaaagaatctagtggactcagacacgaccctaaacgtatcgacgctgtttttcagccttcataaagcacattaacactgttatttttttaataaaatccatgttagccatttagctatgaagctagagtcaccgggcagacagaagccctgcccatcacgcgaatccgcgtctgttctgaagtgaatttgacgcgcgaatgaagcagatttgatgtgcgaatgaagcgagtaacctcaaatgttcacgctgctatttacgcgcaaatagcacgatttatcggtgcgttctgcgtctggtgtgaacacagcattaaaggaatgctttactcaccctttccttaaaatgtaagtttttgtattctgttgaacgctaaggaagatatttgaagaatgccagaaaccagtaaccattgacatccatagtaggaaaaacaaatacagttgaaaccagaagttta

//