GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 03:33:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_131764               1863 bp    mRNA    linear   VRT 25-MAR-2023
DEFINITION  Danio rerio claudin 3d (cldn3d), mRNA.
ACCESSION   NM_131764
VERSION     NM_131764.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1863)
  AUTHORS   Liu Y, Kossack ME, McFaul ME, Christensen LN, Siebert S, Wyatt SR,
            Kamei CN, Horst S, Arroyo N, Drummond IA, Juliano CE and Draper BW.
  TITLE     Single-cell transcriptome reveals insights into the development and
            function of the zebrafish ovary
  JOURNAL   Elife 11, e76014 (2022)
   PUBMED   35588359
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1863)
  AUTHORS   Lukowicz-Bedford RM, Farnsworth DR and Miller AC.
  TITLE     Connexinplexity: the spatial and temporal expression of connexin
            genes during vertebrate organogenesis
  JOURNAL   G3 (Bethesda) 12 (5) (2022)
   PUBMED   35325106
REFERENCE   3  (bases 1 to 1863)
  AUTHORS   Metikala S, Casie Chetty S and Sumanas S.
  TITLE     Single-cell transcriptome analysis of the zebrafish embryonic trunk
  JOURNAL   PLoS One 16 (7), e0254024 (2021)
   PUBMED   34234366
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1863)
  AUTHORS   Luo T, Wang X and Jin Y.
  TITLE     Low concentrations of imidacloprid exposure induced gut toxicity in
            adult zebrafish (Danio rerio)
  JOURNAL   Comp Biochem Physiol C Toxicol Pharmacol 241, 108972 (2021)
   PUBMED   33418081
REFERENCE   5  (bases 1 to 1863)
  AUTHORS   Solis CJ, Hamilton MK, Caruffo M, Garcia-Lopez JP, Navarrete P,
            Guillemin K and Feijoo CG.
  TITLE     Intestinal Inflammation Induced by Soybean Meal Ingestion Increases
            Intestinal Permeability and Neutrophil Turnover Independently of
            Microbiota in Zebrafish
  JOURNAL   Front Immunol 11, 1330 (2020)
   PUBMED   32793187
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1863)
  AUTHORS   Kumai Y, Bahubeshi A, Steele S and Perry SF.
  TITLE     Strategies for maintaining Na balance in zebrafish (Danio rerio)
            during prolonged exposure to acidic water
  JOURNAL   Comp Biochem Physiol A Mol Integr Physiol 160 (1), 52-62 (2011)
   PUBMED   21600298
REFERENCE   7  (bases 1 to 1863)
  AUTHORS   Clelland ES and Kelly SP.
  TITLE     Tight junction proteins in zebrafish ovarian follicles: stage
            specific mRNA abundance and response to 17beta-estradiol, human
            chorionic gonadotropin, and maturation inducing hormone
  JOURNAL   Gen Comp Endocrinol 168 (3), 388-400 (2010)
   PUBMED   20553723
REFERENCE   8  (bases 1 to 1863)
  AUTHORS   Feng L, Hernandez RE, Waxman JS, Yelon D and Moens CB.
  TITLE     Dhrs3a regulates retinoic acid biosynthesis through a feedback
            inhibition mechanism
  JOURNAL   Dev Biol 338 (1), 1-14 (2010)
   PUBMED   19874812
REFERENCE   9  (bases 1 to 1863)
  AUTHORS   Stuckenholz C, Lu L, Thakur P, Kaminski N and Bahary N.
  TITLE     FACS-assisted microarray profiling implicates novel genes and
            pathways in zebrafish gastrointestinal tract development
  JOURNAL   Gastroenterology 137 (4), 1321-1332 (2009)
   PUBMED   19563808
REFERENCE   10 (bases 1 to 1863)
  AUTHORS   Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF359432.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF359432.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1863
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..1863
                     /gene="cldn3d"
                     /gene_synonym="cldnc"
                     /note="claudin 3d"
                     /db_xref="GeneID:81582"
                     /db_xref="ZFIN:ZDB-GENE-010328-3"
     exon            1..1844
                     /gene="cldn3d"
                     /gene_synonym="cldnc"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    148..150
                     /gene="cldn3d"
                     /gene_synonym="cldnc"
                     /note="upstream in-frame stop codon"
     CDS             316..972
                     /gene="cldn3d"
                     /gene_synonym="cldnc"
                     /note="claudin c"
                     /codon_start=1
                     /product="claudin 3d"
                     /protein_id="NP_571839.1"
                     /db_xref="GeneID:81582"
                     /db_xref="ZFIN:ZDB-GENE-010328-3"
                     /translation="
MASFGLELVGVTLSVLGWILNIVCCALPMWRVTAFIGTNIVTAQVYWEGIWMSCVVQSTGQMQCKVYDSMLALPADLQAARALVVVAIIVGVLALFVAIVGAKCTNCIEEEAAKARVMISSGAAFITASVLQLIPVCWSAHTVILEFYSPLVPEAQKMEIGASLYLGWAASAMLLVGGSILCCSCPPKDETRYPPQSRIAYSAHHSVAPSTYNKRDYV"
     misc_feature    328..858
                     /gene="cldn3d"
                     /gene_synonym="cldnc"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
aacagaaagcagctccccttttttattaggacgccaaccaatacttgaatcgcaccttatcatctgatgtcagaaggcaggtaactcagcccttttctcagaaaaggggaagtttctaccaggacagaacattccagccgtccttgttgaggagattcagtgtgtcaacacccacctccatgcctgaacggtcttttggtgattttggagatttctgatgtaattgtctcaaggacttgggcagactttgtgagagcttcagcgagcataagagaaagcaaactgaacattcaacaggagaaagagactggagacatggcgtcttttggtttggagttagtaggtgtcacgctctcagtccttggctggattctcaacattgtttgctgtgctttgcccatgtggagggtcacggcgttcatcggcaccaatatcgtcacagcacaggtgtactgggagggaatctggatgagctgtgtggttcaaagcaccggacagatgcaatgtaaagtctatgactccatgctggctcttcctgcagatctacaggcggctcgcgctctggtggtggtggccatcattgtcggtgtccttgcgctttttgtggctattgtgggagccaaatgcaccaactgcattgaggaggaagcagccaaagcccgtgtgatgatcagctctggagccgctttcataactgcttcagtcttgcagcttattcctgtgtgctggtctgcacatacggtcattcttgagttctacagcccgctggtaccagaagctcagaagatggaaattggagcatcgctgtatctgggctgggctgcttcggcaatgttgcttgttggaggatcaatactgtgctgcagttgcccaccaaaagatgagacgaggtaccctccgcaaagtcgtatcgcctattcagcccaccactcagtggctccaagtacctataacaagagagactatgtctgagaagctcagaggacatttgttttgtagctgtcagtctttccttgaaagataattgtaaacatgtgtgttggaggtaactcagtattgtttacttttgctccatgtaaaagttttggttttgtccattgtcactccacaatgtagttttataattcattttgctgtagttctctgttaggattgcgtttcaaaatccattatataagttgatttaaagtgagaaaatgtcagtgcttatatttgtgtagccttgtgggctttcgttttttgttatttttcagtttttactctttcaccaaagctagttgagaataaatatttttatactttcatctaaaagaattaaacacgatctgctaatccttgaatcgagaaatcttttactaatatgcttgtacattgcttgagttgtgatcaagtctgtaaatgtttagttgtgtctaatgtttatttcagtattgttcttgtttttattcactgaagtgctcaaaaatggacagagaagagtttagatatggaacatgtctagagagcaactttatccttttcgttttcctctcctatctgtgtacgtgttacaaaatacaatactagtgaatgtatgtaaaactacaaaatgggaaaatgtttttgatttatttccctcattcaagagacagaaaaaaagactgaattcaagctcctctggacaaaacaactctgagaaactctgagactctgtgcaggcacctcccaaagtttcctcacattatatactttgcacactttcatgtttgttgtcgttgttttcagcactaccatgtatcttaatagccttgtgataaccattttcacttaaattgttgattattaaatatatatcagtgatgaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]