ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-18 19:01:20, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_131763 1145 bp mRNA linear VRT 05-JUN-2025 DEFINITION Danio rerio claudin b (cldnb), mRNA. ACCESSION NM_131763 VERSION NM_131763.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1145) AUTHORS Chen,F., Kohler,M., Cucun,G., Takamiya,M., Kizil,C., Cosacak,M.I. and Rastegar,S. TITLE sox1a:eGFP transgenic line and single-cell transcriptomics reveal the origin of zebrafish intraspinal serotonergic neurons JOURNAL iScience 26 (8), 107342 (2023) PUBMED 37529101 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1145) AUTHORS Hughes,S.M., Escaleira,R.C., Wanders,K., Koth,J., Wilkinson,D.G. and Xu,Q. TITLE Clonal behaviour of myogenic precursor cells throughout the vertebrate lifespan JOURNAL Biol Open 11 (8) (2022) PUBMED 35972050 REFERENCE 3 (bases 1 to 1145) AUTHORS Lin,M.J., Lee,C.M., Hsu,W.L., Chen,B.C. and Lee,S.J. TITLE Macrophages Break Interneuromast Cell Quiescence by Intervening in the Inhibition of Schwann Cells in the Zebrafish Lateral Line JOURNAL Front Cell Dev Biol 10, 907863 (2022) PUBMED 35846366 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1145) AUTHORS Marsay,K.S., Greaves,S., Mahabaleshwar,H., Ho,C.M., Roehl,H., Monk,P.N., Carney,T.J. and Partridge,L.J. TITLE Tetraspanin Cd9b and Cxcl12a/Cxcr4b have a synergistic effect on the control of collective cell migration JOURNAL PLoS One 16 (11), e0260372 (2021) PUBMED 34847198 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1145) AUTHORS Pradhan,S.J., Reddy,P.C., Smutny,M., Sharma,A., Sako,K., Oak,M.S., Shah,R., Pal,M., Deshpande,O., Dsilva,G., Tang,Y., Mishra,R., Deshpande,G., Giraldez,A.J., Sonawane,M., Heisenberg,C.P. and Galande,S. TITLE Satb2 acts as a gatekeeper for major developmental transitions during early vertebrate embryogenesis JOURNAL Nat Commun 12 (1), 6094 (2021) PUBMED 34667153 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1145) AUTHORS Sarrazin,A.F., Villablanca,E.J., Nunez,V.A., Sandoval,P.C., Ghysen,A. and Allende,M.L. TITLE Proneural gene requirement for hair cell differentiation in the zebrafish lateral line JOURNAL Dev Biol 295 (2), 534-545 (2006) PUBMED 16678150 REFERENCE 7 (bases 1 to 1145) AUTHORS Haas,P. and Gilmour,D. TITLE Chemokine signaling mediates self-organizing tissue migration in the zebrafish lateral line JOURNAL Dev Cell 10 (5), 673-680 (2006) PUBMED 16678780 REFERENCE 8 (bases 1 to 1145) AUTHORS Lopez-Schier,H., Starr,C.J., Kappler,J.A., Kollmar,R. and Hudspeth,A.J. TITLE Directional cell migration establishes the axes of planar polarity in the posterior lateral-line organ of the zebrafish JOURNAL Dev Cell 7 (3), 401-412 (2004) PUBMED 15363414 REFERENCE 9 (bases 1 to 1145) AUTHORS Malek,R.L., Sajadi,H., Abraham,J., Grundy,M.A. and Gerhard,G.S. TITLE The effects of temperature reduction on gene expression and oxidative stress in skeletal muscle from adult zebrafish JOURNAL Comp Biochem Physiol C Toxicol Pharmacol 138 (3), 363-373 (2004) PUBMED 15533794 REFERENCE 10 (bases 1 to 1145) AUTHORS Loh,Y.H., Christoffels,A., Brenner,S., Hunziker,W. and Venkatesh,B. TITLE Extensive expansion of the claudin gene family in the teleost fish, Fugu rubripes JOURNAL Genome Res 14 (7), 1248-1257 (2004) PUBMED 15197168 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JBMGRA010000021.1, BC078358.1 and AF359426.1. On May 1, 2009 this sequence version replaced NM_131763.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: AF359426.1, BC078358.1 [ECO:0000345] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-21 JBMGRA010000021.1 27213540-27213560 22-837 BC078358.1 1-816 838-1145 AF359426.1 813-1120 FEATURES Location/Qualifiers source 1..1145 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="21" /map="21" gene 1..1145 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /note="claudin b" /db_xref="GeneID:81581" /db_xref="ZFIN:ZDB-GENE-010328-2" exon 1..1129 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /inference="alignment:Splign:2.1.0" CDS 69..716 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /codon_start=1 /product="claudin b" /protein_id="NP_571838.1" /db_xref="GeneID:81581" /db_xref="ZFIN:ZDB-GENE-010328-2" /translation="
MASTGLQMLGIALAIFGWIGVIVLCALPMWKVTAFIGANIVTSQTSWEGIWMSCVVQSTGQMQCKVYDSMLALSSDIQAARALTVISIVIGVMGIMLSMAGGKCTNCIEEESSKAKVGITAGVIFIISGVLCLVPVCWTANAIIQDFYNPLVVQAQKREIGASLYIGWGASALLIIGGSLLCCHCPEKSDSGKYTAKYNATPRSEASAPSGKNFV"
misc_feature 78..611
/gene="cldnb"
/gene_synonym="cldn30c; wu:fa66b05"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
ORIGIN
tcacacacacacgcttgataagactgcgaagagaaccaccaaccaaccaacaaggaaaacgaaaaagcatggcatcaaccggcctacagatgctgggcatcgccctggccatctttgggtggatcggagtcattgtgctctgcgcactccccatgtggaaagtcacagccttcatcggcgccaacattgtcacttcacagacatcctgggaaggaatttggatgagctgcgtggttcaaagcactggacagatgcagtgtaaggtctacgactccatgctggctctctcctcagatattcaagccgctcgagctctcaccgtcatctccatcgtgatcggagtcatgggaatcatgctgtcgatggctggtggaaaatgcaccaactgcatcgaggaggagagctccaaagccaaggttgggatcacggcaggtgtgattttcatcatctctggggtgctatgtctggtcccggtgtgctggacggctaacgctatcatccaggacttctacaacccgctagtggtccaggcacagaagagggagattggagcgtcactgtacatcggctggggtgcctcagctctgttgatcattggtggaagtctgctctgttgccactgccccgaaaaatcagacagcggaaaatacacagctaaatacaacgcaacccctcgctctgaagcctctgcaccctccggaaagaactttgtgtaaatgatcaactcaggaaaatggactctacaatgtttacggtcttagtttgttggacattgaggctcaaaatgagtttgcaggacttgaaaagcagatgctgaatgtttttttttttttttttttttaccaatatatatgcaaaacaaacaaagaaaatggggaaccacgtttgaaacagcctctgcagttaaaggaggttaacctgaaaattatttttgcttaagtttggtcaaatgttcttttgtaccgtggtcattataaaagtgttcacttttgtatgttttcaagtatgattttgtaaatattagcatttttgtacagcctaagtacaggtttttctacaactttgtacaggtttatttcttgatatatgtttaaaggaattaataaataaatacattttgttaatatcaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]