2024-05-04 16:03:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131763 1145 bp mRNA linear VRT 21-AUG-2023 DEFINITION Danio rerio claudin b (cldnb), mRNA. ACCESSION NM_131763 VERSION NM_131763.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1145) AUTHORS Hughes SM, Escaleira RC, Wanders K, Koth J, Wilkinson DG and Xu Q. TITLE Clonal behaviour of myogenic precursor cells throughout the vertebrate lifespan JOURNAL Biol Open 11 (8) (2022) PUBMED 35972050 REFERENCE 2 (bases 1 to 1145) AUTHORS Lin MJ, Lee CM, Hsu WL, Chen BC and Lee SJ. TITLE Macrophages Break Interneuromast Cell Quiescence by Intervening in the Inhibition of Schwann Cells in the Zebrafish Lateral Line JOURNAL Front Cell Dev Biol 10, 907863 (2022) PUBMED 35846366 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1145) AUTHORS Marsay KS, Greaves S, Mahabaleshwar H, Ho CM, Roehl H, Monk PN, Carney TJ and Partridge LJ. TITLE Tetraspanin Cd9b and Cxcl12a/Cxcr4b have a synergistic effect on the control of collective cell migration JOURNAL PLoS One 16 (11), e0260372 (2021) PUBMED 34847198 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1145) AUTHORS Dalle Nogare DE, Natesh N, Vishwasrao HD, Shroff H and Chitnis AB. TITLE Zebrafish Posterior Lateral Line primordium migration requires interactions between a superficial sheath of motile cells and the skin JOURNAL Elife 9, e58251 (2020) PUBMED 33237853 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1145) AUTHORS Solis CJ, Hamilton MK, Caruffo M, Garcia-Lopez JP, Navarrete P, Guillemin K and Feijoo CG. TITLE Intestinal Inflammation Induced by Soybean Meal Ingestion Increases Intestinal Permeability and Neutrophil Turnover Independently of Microbiota in Zebrafish JOURNAL Front Immunol 11, 1330 (2020) PUBMED 32793187 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1145) AUTHORS Sarrazin AF, Villablanca EJ, Nunez VA, Sandoval PC, Ghysen A and Allende ML. TITLE Proneural gene requirement for hair cell differentiation in the zebrafish lateral line JOURNAL Dev Biol 295 (2), 534-545 (2006) PUBMED 16678150 REFERENCE 7 (bases 1 to 1145) AUTHORS Haas P and Gilmour D. TITLE Chemokine signaling mediates self-organizing tissue migration in the zebrafish lateral line JOURNAL Dev Cell 10 (5), 673-680 (2006) PUBMED 16678780 REFERENCE 8 (bases 1 to 1145) AUTHORS Lopez-Schier H, Starr CJ, Kappler JA, Kollmar R and Hudspeth AJ. TITLE Directional cell migration establishes the axes of planar polarity in the posterior lateral-line organ of the zebrafish JOURNAL Dev Cell 7 (3), 401-412 (2004) PUBMED 15363414 REFERENCE 9 (bases 1 to 1145) AUTHORS Malek RL, Sajadi H, Abraham J, Grundy MA and Gerhard GS. TITLE The effects of temperature reduction on gene expression and oxidative stress in skeletal muscle from adult zebrafish JOURNAL Comp Biochem Physiol C Toxicol Pharmacol 138 (3), 363-373 (2004) PUBMED 15533794 REFERENCE 10 (bases 1 to 1145) AUTHORS Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B. TITLE Extensive expansion of the claudin gene family in the teleost fish, Fugu rubripes JOURNAL Genome Res 14 (7), 1248-1257 (2004) PUBMED 15197168 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CR847847.6, BC078358.1 and AF359426.1. On May 1, 2009 this sequence version replaced NM_131763.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-21 CR847847.6 60310-60330 c 22-837 BC078358.1 1-816 838-1145 AF359426.1 813-1120 FEATURES Location/Qualifiers source 1..1145 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="21" /map="21" gene 1..1145 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /note="claudin b" /db_xref="GeneID:81581" /db_xref="ZFIN:ZDB-GENE-010328-2" exon 1..1129 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /inference="alignment:Splign:2.1.0" CDS 69..716 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /codon_start=1 /product="claudin b" /protein_id="NP_571838.1" /db_xref="GeneID:81581" /db_xref="ZFIN:ZDB-GENE-010328-2" /translation="
MASTGLQMLGIALAIFGWIGVIVLCALPMWKVTAFIGANIVTSQTSWEGIWMSCVVQSTGQMQCKVYDSMLALSSDIQAARALTVISIVIGVMGIMLSMAGGKCTNCIEEESSKAKVGITAGVIFIISGVLCLVPVCWTANAIIQDFYNPLVVQAQKREIGASLYIGWGASALLIIGGSLLCCHCPEKSDSGKYTAKYNATPRSEASAPSGKNFV"
misc_feature 78..611 /gene="cldnb" /gene_synonym="cldn30c; wu:fa66b05" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
tcacacacacacgcttgataagactgcgaagagaaccaccaaccaaccaacaaggaaaacgaaaaagcatggcatcaaccggcctacagatgctgggcatcgccctggccatctttgggtggatcggagtcattgtgctctgcgcactccccatgtggaaagtcacagccttcatcggcgccaacattgtcacttcacagacatcctgggaaggaatttggatgagctgcgtggttcaaagcactggacagatgcagtgtaaggtctacgactccatgctggctctctcctcagatattcaagccgctcgagctctcaccgtcatctccatcgtgatcggagtcatgggaatcatgctgtcgatggctggtggaaaatgcaccaactgcatcgaggaggagagctccaaagccaaggttgggatcacggcaggtgtgattttcatcatctctggggtgctatgtctggtcccggtgtgctggacggctaacgctatcatccaggacttctacaacccgctagtggtccaggcacagaagagggagattggagcgtcactgtacatcggctggggtgcctcagctctgttgatcattggtggaagtctgctctgttgccactgccccgaaaaatcagacagcggaaaatacacagctaaatacaacgcaacccctcgctctgaagcctctgcaccctccggaaagaactttgtgtaaatgatcaactcaggaaaatggactctacaatgtttacggtcttagtttgttggacattgaggctcaaaatgagtttgcaggacttgaaaagcagatgctgaatgtttttttttttttttttttttaccaatatatatgcaaaacaaacaaagaaaatggggaaccacgtttgaaacagcctctgcagttaaaggaggttaacctgaaaattatttttgcttaagtttggtcaaatgttcttttgtaccgtggtcattataaaagtgttcacttttgtatgttttcaagtatgattttgtaaatattagcatttttgtacagcctaagtacaggtttttctacaactttgtacaggtttatttcttgatatatgtttaaaggaattaataaataaatacattttgttaatatcaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]