2024-05-06 13:10:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131546 1582 bp mRNA linear VRT 15-MAY-2023 DEFINITION Danio rerio homeobox C13b (hoxc13b), mRNA. ACCESSION NM_131546 VERSION NM_131546.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1582) AUTHORS Banu S, Gaur N, Nair S, Ravikrishnan T, Khan S, Mani S, Bharathi S, Mandal K, Kuram NA, Vuppaladadium S, Ravi R, Murthy CLN, Quoseena M, Babu NS and Idris MM. TITLE Understanding the complexity of epimorphic regeneration in zebrafish caudal fin tissue: A transcriptomic and proteomic approach JOURNAL Genomics 114 (2), 110300 (2022) PUBMED 35134499 REFERENCE 2 (bases 1 to 1582) AUTHORS Yamada K, Maeno A, Araki S, Kikuchi M, Suzuki M, Ishizaka M, Satoh K, Akama K, Kawabe Y, Suzuki K, Kobayashi D, Hamano N and Kawamura A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 3 (bases 1 to 1582) AUTHORS Ye Z and Kimelman D. TITLE Hox13 genes are required for mesoderm formation and axis elongation during early zebrafish development JOURNAL Development 147 (22) (2020) PUBMED 33154036 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1582) AUTHORS Soh GH, Pomreinke AP and Muller P. TITLE Integration of Nodal and BMP Signaling by Mutual Signaling Effector Antagonism JOURNAL Cell Rep 31 (1), 107487 (2020) PUBMED 32268105 REFERENCE 5 (bases 1 to 1582) AUTHORS Malmstrom M, Britz R, Matschiner M, Torresen OK, Hadiaty RK, Yaakob N, Tan HH, Jakobsen KS, Salzburger W and Ruber L. TITLE The Most Developmentally Truncated Fishes Show Extensive Hox Gene Loss and Miniaturized Genomes JOURNAL Genome Biol Evol 10 (4), 1088-1103 (2018) PUBMED 29684203 REFERENCE 6 (bases 1 to 1582) AUTHORS Kurosawa G, Takamatsu N, Takahashi M, Sumitomo M, Sanaka E, Yamada K, Nishii K, Matsuda M, Asakawa S, Ishiguro H, Miura K, Kurosawa Y, Shimizu N, Kohara Y and Hori H. TITLE Organization and structure of hox gene loci in medaka genome and comparison with those of pufferfish and zebrafish genomes JOURNAL Gene 370, 75-82 (2006) PUBMED 16472944 REMARK Erratum:[Gene. 2006 Jul;376(2):298-9] REFERENCE 7 (bases 1 to 1582) AUTHORS Phillips RB, Amores A, Morasch MR, Wilson C and Postlethwait JH. TITLE Assignment of zebrafish genetic linkage groups to chromosomes JOURNAL Cytogenet Genome Res 114 (2), 155-162 (2006) PUBMED 16825768 REFERENCE 8 (bases 1 to 1582) AUTHORS Corredor-Adamez M, Welten MC, Spaink HP, Jeffery JE, Schoon RT, de Bakker MA, Bagowski CP, Meijer AH, Verbeek FJ and Richardson MK. TITLE Genomic annotation and transcriptome analysis of the zebrafish (Danio rerio) hox complex with description of a novel member, hox b 13a JOURNAL Evol Dev 7 (5), 362-375 (2005) PUBMED 16174031 REFERENCE 9 (bases 1 to 1582) AUTHORS Santini S and Bernardi G. TITLE Organization and base composition of tilapia Hox genes: implications for the evolution of Hox clusters in fish JOURNAL Gene 346, 51-61 (2005) PUBMED 15716008 REFERENCE 10 (bases 1 to 1582) AUTHORS Thummel R, Li L, Tanase C, Sarras MP Jr and Godwin AR. TITLE Differences in expression pattern and function between zebrafish hoxc13 orthologs: recruitment of Hoxc13b into an early embryonic role JOURNAL Dev Biol 274 (2), 318-333 (2004) PUBMED 15385162 REMARK GeneRIF: maternally expressed and is detectable in every cell of early cleavage embryos through gastrulae COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC139597.1. On Apr 22, 2007 this sequence version replaced NM_131546.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC139597.1, AY452738.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505373, SAMEA3505374 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1582 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="11" /map="11" gene 1..1582 /gene="hoxc13b" /gene_synonym="hoxf13" /note="homeobox C13b" /db_xref="GeneID:58063" /db_xref="ZFIN:ZDB-GENE-000822-5" exon 1..690 /gene="hoxc13b" /gene_synonym="hoxf13" /inference="alignment:Splign:2.1.0" misc_feature 78..80 /gene="hoxc13b" /gene_synonym="hoxf13" /note="upstream in-frame stop codon" CDS 132..953 /gene="hoxc13b" /gene_synonym="hoxf13" /note="homeobox gene F-13; homeo box C13b" /codon_start=1 /product="homeobox protein Hox-C13b" /protein_id="NP_571621.2" /db_xref="GeneID:58063" /db_xref="ZFIN:ZDB-GENE-000822-5" /translation="
MEGLSGNCPASHCRDFISHPALGRHSGSLASHQGTVYPDITTQDAGRQFPAPQASSGTSLGYGYAFGSPYYGCRLSYSHNVNLQQKSYHPAEKYMETSGALPAEELSSRSKEFAIYPSFASSYQTVPGYLDVPVVPGISAHPESRHEALFPMDSYQHWALSNGWDEQLYCSKEQTHFNHLWKSQFSDVVPHQAEMNGYRRGRKKRVPYTKIQLKELEKEYAASKFITKDRRRRISATTSLSERQVTIWFQNRRVKEKKFVCKSSKLSTNMHSV"
misc_feature 132..458 /gene="hoxc13b" /gene_synonym="hoxf13" /note="Hox protein A13 N terminal; Region: HoxA13_N; pfam12284" /db_xref="CDD:432453" misc_feature order(735..749,753..755,804..806,822..824,861..863, 867..872,879..884,888..896,900..905) /gene="hoxc13b" /gene_synonym="hoxf13" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 741..902 /gene="hoxc13b" /gene_synonym="hoxf13" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(741..743,750..752,870..872,879..884,891..893) /gene="hoxc13b" /gene_synonym="hoxf13" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 691..1552 /gene="hoxc13b" /gene_synonym="hoxf13" /inference="alignment:Splign:2.1.0" ORIGIN
gtagtcgagttttaaaaagcatcgacaacccatgaccatgatttcgccgatcctgcatggacgctgggcggacacactgatttacgtgtaatgagaaaaaaacctcgaatgaaagttattctcataaaaccatggagggactgagcgggaattgccctgcctctcattgcagggattttatctcgcaccctgcgctgggacgccactctgggagcctcgcgagtcaccagggcacagtgtacccggatatcacgacacaagatgccggccggcaattccctgcgccccaggcctcgtcggggacttcactgggctatggatacgcattcgggagtccatattatgggtgtcgtctttcctactctcacaacgtaaacttgcaacagaagtcataccatcctgccgaaaaatacatggaaacaagcggtgcgctgccagctgaagagctttccagccggtcaaaagaatttgctatttacccaagcttcgccagctcttatcaaactgtccctggctatttggacgtcccagttgtgccaggaatcagtgcgcacccagaatccaggcatgaagcgttgtttcctatggacagttatcagcactgggcactgtcgaacggctgggatgagcaattgtattgttctaaggaacaaacacattttaaccacctatggaaatcccaattttcggatgtggtgccacaccaagccgagatgaacggctaccgtcgcggtcgtaagaagagggtaccttacactaaaatccaattaaaggaactggaaaaggagtatgcagccagcaagttcatcaccaaagacagaagaaggcgcatctccgccacaacgagtctctccgagcgccaggtgaccatctggttccagaaccgacgtgttaaggaaaagaagttcgtttgtaaatcctcaaagttaagcactaacatgcattcagtttgattattttcggtgttctttggctcgacaaattcatcaaggaatttctttttatttaagtgggcttaataaggcctaaatatgacggcggatccgacacagacctatgcatcgatgaggtcctgcatttacagatgtagtagacctaagctgcagtaagaaatgagtttccagaagacattcacacatgaatcgctttataacatttctgttttttaactccatgttgttacaactttcaacctttctgttggtactgttgttgttgtttaatgaaaaagaaatggaaattgtttgttaagactacgatggaggcatagttttaactccattttaacttttaaaaaagttttcaattcaaatatagtaatatgtatgtcaaaatgttcggttatcaaaacgtaatgtcatccatgaattggttaatattcatctgtcaatgtacttttccctcgtggtgtgttttctcaattttatagcaatggtgtcgtgtttaaaaacgatttaaagtgtttaggagctgaaataaagcttagcgttaggtttgaacacaagaaaatcacacacttatttcccccaatattaaactgtttgtgttatgtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]