LOCUS       NM_001115098             957 bp    mRNA    linear   VRT 16-OCT-2021
DEFINITION  Danio rerio H6 family homeobox 2 (hmx2), mRNA.
ACCESSION   NM_001115098 XM_005158693 XM_678199
VERSION     NM_001115098.3
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 957)
  AUTHORS   England SJ, Cerda GA, Kowalchuk A, Sorice T, Grieb G and Lewis KE.
  TITLE     Hmx3a Has Essential Functions in Zebrafish Spinal Cord, Ear and
            Lateral Line Development
  JOURNAL   Genetics 216 (4), 1153-1185 (2020)
   PUBMED   33077489
REFERENCE   2  (bases 1 to 957)
  AUTHORS   Hartwell RD, England SJ, Monk NAM, van Hateren NJ, Baxendale S,
            Marzo M, Lewis KE and Whitfield TT.
  TITLE     Anteroposterior patterning of the zebrafish ear through Fgf- and
            Hh-dependent regulation of hmx3a expression
  JOURNAL   PLoS Genet 15 (4), e1008051 (2019)
   PUBMED   31022185
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 957)
  AUTHORS   Ladam F, Stanney W, Donaldson IJ, Yildiz O, Bobola N and Sagerstrom
            CG.
  TITLE     TALE factors use two distinct functional modes to control an
            essential zebrafish gene expression program
  JOURNAL   Elife 7, e36144 (2018)
   PUBMED   29911973
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 957)
  AUTHORS   Nikaido M, Navajas Acedo J, Hatta K and Piotrowski T.
  TITLE     Retinoic acid is required and Fgf, Wnt, and Bmp signaling inhibit
            posterior lateral line placode induction in zebrafish
  JOURNAL   Dev Biol 431 (2), 215-225 (2017)
   PUBMED   28923486
REFERENCE   5  (bases 1 to 957)
  AUTHORS   Ott E, Wendik B, Srivastava M, Pacho F, Tochterle S, Salvenmoser W
            and Meyer D.
  TITLE     Pronephric tubule morphogenesis in zebrafish depends on Mnx
            mediated repression of irx1b within the intermediate mesoderm
  JOURNAL   Dev Biol 411 (1), 101-114 (2016)
   PUBMED   26472045
REFERENCE   6  (bases 1 to 957)
  AUTHORS   Hu ZY, Zhang QY, Qin W, Tong JW, Zhao Q, Han Y, Meng J and Zhang
            JP.
  TITLE     Gene miles-apart is required for formation of otic vesicle and hair
            cells in zebrafish
  JOURNAL   Cell Death Dis 4, e900 (2013)
   PUBMED   24176858
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 957)
  AUTHORS   Hammond KL and Whitfield TT.
  TITLE     Fgf and Hh signalling act on a symmetrical pre-pattern to specify
            anterior and posterior identity in the zebrafish otic placode and
            vesicle
  JOURNAL   Development 138 (18), 3977-3987 (2011)
   PUBMED   21831919
REFERENCE   8  (bases 1 to 957)
  AUTHORS   Aman A, Nguyen M and Piotrowski T.
  TITLE     Wnt/beta-catenin dependent cell proliferation underlies segmented
            lateral line morphogenesis
  JOURNAL   Dev Biol 349 (2), 470-482 (2011)
   PUBMED   20974120
REFERENCE   9  (bases 1 to 957)
  AUTHORS   Feng Y and Xu Q.
  TITLE     Pivotal role of hmx2 and hmx3 in zebrafish inner ear and lateral
            line development
  JOURNAL   Dev Biol 339 (2), 507-518 (2010)
   PUBMED   20043901
  REMARK    GeneRIF: hmx2 acts as cell autonomous factors required redundantly
            for cell fate specification and differentiation during inner ear
            and lateral line development
REFERENCE   10 (bases 1 to 957)
  AUTHORS   Wotton KR, Weierud FK, Juarez-Morales JL, Alvares LE, Dietrich S
            and Lewis KE.
  TITLE     Conservation of gene linkage in dispersed vertebrate NK homeobox
            clusters
  JOURNAL   Dev Genes Evol 219 (9-10), 481-496 (2009)
   PUBMED   20112453
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL773596.12.
            
            On or before Jul 29, 2017 this sequence version replaced
            XM_005158693.4, NM_001115098.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR931347.1, GDQH01027994.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-409               AL773596.12        173008-173416
            410-957             AL773596.12        174196-174743
FEATURES             Location/Qualifiers
     source          1..957
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="17"
                     /map="17"
     gene            1..957
                     /gene="hmx2"
                     /note="H6 family homeobox 2"
                     /db_xref="GeneID:555632"
                     /db_xref="ZFIN:ZDB-GENE-080506-2"
     exon            1..409
                     /gene="hmx2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    91..93
                     /gene="hmx2"
                     /note="upstream in-frame stop codon"
     CDS             148..957
                     /gene="hmx2"
                     /note="homeobox transcription factor Hmx2; nkx5.2"
                     /codon_start=1
                     /product="homeobox protein HMX2"
                     /protein_id="NP_001108570.3"
                     /db_xref="GeneID:555632"
                     /db_xref="ZFIN:ZDB-GENE-080506-2"
                     /translation="

MNNSEDSGSKCSPAPISSFTIQSILGTSNDGVRSAGKDSPKSQPRKRTLSVSSEDDCSAGEDSGDCYCSEPGVPESCNPHQPLNFCLGATKGLLPVQDGIDRRPHLTPSILPDYKEEQGRACSQMSPVSEDRQRDGPDKQNNSAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVGMPLVFRENSLLRVPVPRSIAFPTPLYYPGSNLPALPLYNLYNKIEY"

     misc_feature    order(583..597,601..603,652..654,670..672,709..711,
                     715..720,727..732,736..744,748..753)
                     /gene="hmx2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    589..750
                     /gene="hmx2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(589..591,598..600,718..720,727..732,739..741)
                     /gene="hmx2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            410..957
                     /gene="hmx2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

acatttgagcccacgaaaaacaagtttttttatcgtcccaacagctataaagaagcagtttaaaatttgaaggaaagcactctctatgtgtagcgggacttattgctgatcatttttagaacatttttgaactgttatgagacgagaatgaataattcggaggacagcggaagcaagtgctcgcctgcccccatttcaagtttcacgatccagtctattctgggcacctcaaacgacggagtccggtcggctggaaaggacagtcccaaatcccagccaaggaagcggacgttgtccgtgtcgtcggaggatgactgcagcgcaggagaggactcgggtgactgctactgctctgagcctggtgtaccagagtcctgcaacccgcaccagcctctgaacttctgtctcggtgccacaaagggacttctacctgtgcaagatgggatcgaccgccggccgcatttgacaccatccatactaccggattacaaagaggagcaggggcgagcgtgtagccaaatgtctcccgtttctgaagacagacaacgcgacgggccggacaaacagaacaactccgcgaagaagaaaacgcgcaccgttttctctcggagtcaggtttatcaactcgagtccacattcgatatgaaacgctatttgagcagctccgagagagcctgtctcgcctccagcctgcagttaacggagacacaagtgaaaacgtggtttcagaaccggcgaaacaaatggaagcggcagctctctgcagaacttgaagctgcgaacatggcgcacgcatcggcgcagactttggttgggatgcccctcgttttcagagaaaattcgttgctccgggtgccggttccgaggtccatcgcttttcctaccccactgtattatcctggaagtaatttaccagctttaccactatacaatctttacaacaagattgaatattaa

//