2024-05-06 10:24:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001115098 957 bp mRNA linear VRT 16-OCT-2021 DEFINITION Danio rerio H6 family homeobox 2 (hmx2), mRNA. ACCESSION NM_001115098 XM_005158693 XM_678199 VERSION NM_001115098.3 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 957) AUTHORS England SJ, Cerda GA, Kowalchuk A, Sorice T, Grieb G and Lewis KE. TITLE Hmx3a Has Essential Functions in Zebrafish Spinal Cord, Ear and Lateral Line Development JOURNAL Genetics 216 (4), 1153-1185 (2020) PUBMED 33077489 REFERENCE 2 (bases 1 to 957) AUTHORS Hartwell RD, England SJ, Monk NAM, van Hateren NJ, Baxendale S, Marzo M, Lewis KE and Whitfield TT. TITLE Anteroposterior patterning of the zebrafish ear through Fgf- and Hh-dependent regulation of hmx3a expression JOURNAL PLoS Genet 15 (4), e1008051 (2019) PUBMED 31022185 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 957) AUTHORS Ladam F, Stanney W, Donaldson IJ, Yildiz O, Bobola N and Sagerstrom CG. TITLE TALE factors use two distinct functional modes to control an essential zebrafish gene expression program JOURNAL Elife 7, e36144 (2018) PUBMED 29911973 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 957) AUTHORS Nikaido M, Navajas Acedo J, Hatta K and Piotrowski T. TITLE Retinoic acid is required and Fgf, Wnt, and Bmp signaling inhibit posterior lateral line placode induction in zebrafish JOURNAL Dev Biol 431 (2), 215-225 (2017) PUBMED 28923486 REFERENCE 5 (bases 1 to 957) AUTHORS Ott E, Wendik B, Srivastava M, Pacho F, Tochterle S, Salvenmoser W and Meyer D. TITLE Pronephric tubule morphogenesis in zebrafish depends on Mnx mediated repression of irx1b within the intermediate mesoderm JOURNAL Dev Biol 411 (1), 101-114 (2016) PUBMED 26472045 REFERENCE 6 (bases 1 to 957) AUTHORS Hu ZY, Zhang QY, Qin W, Tong JW, Zhao Q, Han Y, Meng J and Zhang JP. TITLE Gene miles-apart is required for formation of otic vesicle and hair cells in zebrafish JOURNAL Cell Death Dis 4, e900 (2013) PUBMED 24176858 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 957) AUTHORS Hammond KL and Whitfield TT. TITLE Fgf and Hh signalling act on a symmetrical pre-pattern to specify anterior and posterior identity in the zebrafish otic placode and vesicle JOURNAL Development 138 (18), 3977-3987 (2011) PUBMED 21831919 REFERENCE 8 (bases 1 to 957) AUTHORS Aman A, Nguyen M and Piotrowski T. TITLE Wnt/beta-catenin dependent cell proliferation underlies segmented lateral line morphogenesis JOURNAL Dev Biol 349 (2), 470-482 (2011) PUBMED 20974120 REFERENCE 9 (bases 1 to 957) AUTHORS Feng Y and Xu Q. TITLE Pivotal role of hmx2 and hmx3 in zebrafish inner ear and lateral line development JOURNAL Dev Biol 339 (2), 507-518 (2010) PUBMED 20043901 REMARK GeneRIF: hmx2 acts as cell autonomous factors required redundantly for cell fate specification and differentiation during inner ear and lateral line development REFERENCE 10 (bases 1 to 957) AUTHORS Wotton KR, Weierud FK, Juarez-Morales JL, Alvares LE, Dietrich S and Lewis KE. TITLE Conservation of gene linkage in dispersed vertebrate NK homeobox clusters JOURNAL Dev Genes Evol 219 (9-10), 481-496 (2009) PUBMED 20112453 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL773596.12. On or before Jul 29, 2017 this sequence version replaced XM_005158693.4, NM_001115098.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CR931347.1, GDQH01027994.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA2168446, SAMEA2168447 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-409 AL773596.12 173008-173416 410-957 AL773596.12 174196-174743 FEATURES Location/Qualifiers source 1..957 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="17" /map="17" gene 1..957 /gene="hmx2" /note="H6 family homeobox 2" /db_xref="GeneID:555632" /db_xref="ZFIN:ZDB-GENE-080506-2" exon 1..409 /gene="hmx2" /inference="alignment:Splign:2.1.0" misc_feature 91..93 /gene="hmx2" /note="upstream in-frame stop codon" CDS 148..957 /gene="hmx2" /note="homeobox transcription factor Hmx2; nkx5.2" /codon_start=1 /product="homeobox protein HMX2" /protein_id="NP_001108570.3" /db_xref="GeneID:555632" /db_xref="ZFIN:ZDB-GENE-080506-2" /translation="
MNNSEDSGSKCSPAPISSFTIQSILGTSNDGVRSAGKDSPKSQPRKRTLSVSSEDDCSAGEDSGDCYCSEPGVPESCNPHQPLNFCLGATKGLLPVQDGIDRRPHLTPSILPDYKEEQGRACSQMSPVSEDRQRDGPDKQNNSAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVGMPLVFRENSLLRVPVPRSIAFPTPLYYPGSNLPALPLYNLYNKIEY"
misc_feature order(583..597,601..603,652..654,670..672,709..711, 715..720,727..732,736..744,748..753) /gene="hmx2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 589..750 /gene="hmx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(589..591,598..600,718..720,727..732,739..741) /gene="hmx2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 410..957 /gene="hmx2" /inference="alignment:Splign:2.1.0" ORIGIN
acatttgagcccacgaaaaacaagtttttttatcgtcccaacagctataaagaagcagtttaaaatttgaaggaaagcactctctatgtgtagcgggacttattgctgatcatttttagaacatttttgaactgttatgagacgagaatgaataattcggaggacagcggaagcaagtgctcgcctgcccccatttcaagtttcacgatccagtctattctgggcacctcaaacgacggagtccggtcggctggaaaggacagtcccaaatcccagccaaggaagcggacgttgtccgtgtcgtcggaggatgactgcagcgcaggagaggactcgggtgactgctactgctctgagcctggtgtaccagagtcctgcaacccgcaccagcctctgaacttctgtctcggtgccacaaagggacttctacctgtgcaagatgggatcgaccgccggccgcatttgacaccatccatactaccggattacaaagaggagcaggggcgagcgtgtagccaaatgtctcccgtttctgaagacagacaacgcgacgggccggacaaacagaacaactccgcgaagaagaaaacgcgcaccgttttctctcggagtcaggtttatcaactcgagtccacattcgatatgaaacgctatttgagcagctccgagagagcctgtctcgcctccagcctgcagttaacggagacacaagtgaaaacgtggtttcagaaccggcgaaacaaatggaagcggcagctctctgcagaacttgaagctgcgaacatggcgcacgcatcggcgcagactttggttgggatgcccctcgttttcagagaaaattcgttgctccgggtgccggttccgaggtccatcgcttttcctaccccactgtattatcctggaagtaatttaccagctttaccactatacaatctttacaacaagattgaatattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]