GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 12:43:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001083864             942 bp    mRNA    linear   VRT 16-SEP-2023
DEFINITION  Danio rerio taste receptor, type 2, member 201, tandem duplicate 1
            (tas2r201.1), mRNA.
ACCESSION   NM_001083864 XM_001336174
VERSION     NM_001083864.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 942)
  AUTHORS   Kowatschew D and Korsching SI.
  TITLE     An Ancient Adenosine Receptor Gains Olfactory Function in Bony
            Vertebrates
  JOURNAL   Genome Biol Evol 13 (9) (2021)
   PUBMED   34499158
REFERENCE   2  (bases 1 to 942)
  AUTHORS   Behrens M, Di Pizio A, Redel U, Meyerhof W and Korsching SI.
  TITLE     At the Root of T2R Gene Evolution: Recognition Profiles of
            Coelacanth and Zebrafish Bitter Receptors
  JOURNAL   Genome Biol Evol 13 (1) (2021)
   PUBMED   33355666
REFERENCE   3  (bases 1 to 942)
  AUTHORS   Ohmoto M, Okada S, Nakamura S, Abe K and Matsumoto I.
  TITLE     Mutually exclusive expression of Galphaia and Galpha14 reveals
            diversification of taste receptor cells in zebrafish
  JOURNAL   J Comp Neurol 519 (8), 1616-1629 (2011)
   PUBMED   21452212
REFERENCE   4  (bases 1 to 942)
  AUTHORS   Oike H, Nagai T, Furuyama A, Okada S, Aihara Y, Ishimaru Y, Marui
            T, Matsumoto I, Misaka T and Abe K.
  TITLE     Characterization of ligands for fish taste receptors
  JOURNAL   J Neurosci 27 (21), 5584-5592 (2007)
   PUBMED   17522303
REFERENCE   5  (bases 1 to 942)
  AUTHORS   Go Y.
  CONSRTM   SMBE Tri-National Young Investigators
  TITLE     Proceedings of the SMBE Tri-National Young Investigators' Workshop
            2005. Lineage-specific expansions and contractions of the bitter
            taste receptor gene repertoire in vertebrates
  JOURNAL   Mol Biol Evol 23 (5), 964-972 (2006)
   PUBMED   16484289
REFERENCE   6  (bases 1 to 942)
  AUTHORS   Ishimaru Y, Okada S, Naito H, Nagai T, Yasuoka A, Matsumoto I and
            Abe K.
  TITLE     Two families of candidate taste receptors in fishes
  JOURNAL   Mech Dev 122 (12), 1310-1321 (2005)
   PUBMED   16274966
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB249825.1.
            
            On Apr 5, 2007 this sequence version replaced XM_001336174.1.
FEATURES             Location/Qualifiers
     source          1..942
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="9"
                     /map="9"
     gene            1..942
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /note="taste receptor, type 2, member 201, tandem
                     duplicate 1"
                     /db_xref="GeneID:795929"
                     /db_xref="ZFIN:ZDB-GENE-070917-5"
     CDS             1..942
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /note="bitter taste receptor; taste receptor, type 2,
                     member 2a; zfT2R2a; taste receptor, type 2, member 201.1"
                     /codon_start=1
                     /product="taste receptor, type 2, member 201, tandem
                     duplicate 1"
                     /protein_id="NP_001077333.1"
                     /db_xref="GeneID:795929"
                     /db_xref="ZFIN:ZDB-GENE-070917-5"
                     /translation="
MGFFFVYISFLAYALVNVPVSIITILMNVFFVYCMFSSEKGQANSVKPPLNVLLWSLIGCSLLHNIFNLLFVLYELVYPPVWLYIISGATILFAMRTSFTACLGLQICYFLQIVPVRWPCFIWMKKHIKLFMYVLLFLDRLYFLSQYVIRVFLEIRRVVMSFNSSSVYDNTTSQSADFGYYMFIADFWLKCCYFFICLGIMLTSGITTVVYLWKHMKRMKENTSSLSALCKRQQMRVTIMGIIQTVLFFFASGWLMTEEFIECYFGGYDVGTHLASTVMALYSLGTTLLLGIGQSKFRLLAKDICKKTRKPKS"
     misc_feature    <202..>678
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:452889"
     misc_feature    253..321
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410628"
     misc_feature    400..459
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410628"
     misc_feature    544..618
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410628"
     exon            1..942
                     /gene="tas2r201.1"
                     /gene_synonym="tas2r2a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgggtttcttttttgtttacattagcttcttggcctatgccttagtcaatgtgccagtttctattatcactatcctgatgaacgtattttttgtgtactgtatgttttcttcagagaaaggacaagcaaacagtgtaaaaccgccgctgaatgttttgctgtggtcccttattggatgcagtcttcttcataacattttcaaccttttatttgttttgtatgaattagtttacccacctgtctggctgtacattatttcaggtgctactatacttttcgccatgaggacaagttttactgcatgcctcggtctgcaaatttgttacttcttgcagattgttccagtccgatggccttgctttatctggatgaagaagcacatcaaactcttcatgtacgtcttgttgtttctcgacagactctactttctgtctcaatatgtcatacgtgtttttcttgagattcggagggtagtgatgtcctttaattcatccagcgtttatgacaacaccaccagccagtcagcagatttcggatactacatgtttatcgcagacttttggctgaaatgttgctattttttcatttgtcttggcattatgctgacgtcaggcatcacgactgtcgtctacttgtggaagcacatgaagagaatgaaggagaacaccagctctttatctgctctttgtaaaaggcagcagatgagagtgaccatcatgggcatcattcagacggtcctcttcttctttgcttcagggtggctcatgactgaagagttcattgagtgttattttggtggttatgatgtgggcacccatttggcttctactgtaatggcactgtattctcttggaacgaccttacttttagggattggtcagtccaaattccgacttctggctaaggatatctgcaaaaagacaagaaaaccaaaatcctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]