LOCUS       NM_001083864             942 bp    mRNA    linear   VRT 02-APR-2025
DEFINITION  Danio rerio taste receptor, type 2, member 201, tandem duplicate 1
            (tas2r201.1), mRNA.
ACCESSION   NM_001083864 XM_001336174
VERSION     NM_001083864.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 942)
  AUTHORS   Kowatschew,D. and Korsching,S.I.
  TITLE     An Ancient Adenosine Receptor Gains Olfactory Function in Bony
            Vertebrates
  JOURNAL   Genome Biol Evol 13 (9) (2021)
   PUBMED   34499158
REFERENCE   2  (bases 1 to 942)
  AUTHORS   Behrens,M., Di Pizio,A., Redel,U., Meyerhof,W. and Korsching,S.I.
  TITLE     At the Root of T2R Gene Evolution: Recognition Profiles of
            Coelacanth and Zebrafish Bitter Receptors
  JOURNAL   Genome Biol Evol 13 (1) (2021)
   PUBMED   33355666
REFERENCE   3  (bases 1 to 942)
  AUTHORS   Ohmoto,M., Okada,S., Nakamura,S., Abe,K. and Matsumoto,I.
  TITLE     Mutually exclusive expression of Galphaia and Galpha14 reveals
            diversification of taste receptor cells in zebrafish
  JOURNAL   J Comp Neurol 519 (8), 1616-1629 (2011)
   PUBMED   21452212
REFERENCE   4  (bases 1 to 942)
  AUTHORS   Oike,H., Nagai,T., Furuyama,A., Okada,S., Aihara,Y., Ishimaru,Y.,
            Marui,T., Matsumoto,I., Misaka,T. and Abe,K.
  TITLE     Characterization of ligands for fish taste receptors
  JOURNAL   J Neurosci 27 (21), 5584-5592 (2007)
   PUBMED   17522303
REFERENCE   5  (bases 1 to 942)
  AUTHORS   Go,Y.
  CONSRTM   SMBE Tri-National Young Investigators
  TITLE     Proceedings of the SMBE Tri-National Young Investigators' Workshop
            2005. Lineage-specific expansions and contractions of the bitter
            taste receptor gene repertoire in vertebrates
  JOURNAL   Mol Biol Evol 23 (5), 964-972 (2006)
   PUBMED   16484289
REFERENCE   6  (bases 1 to 942)
  AUTHORS   Ishimaru,Y., Okada,S., Naito,H., Nagai,T., Yasuoka,A., Matsumoto,I.
            and Abe,K.
  TITLE     Two families of candidate taste receptors in fishes
  JOURNAL   Mech Dev 122 (12), 1310-1321 (2005)
   PUBMED   16274966
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB249825.1.
            
            On Apr 5, 2007 this sequence version replaced XM_001336174.1.
FEATURES             Location/Qualifiers
     source          1..942
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="9"
                     /map="9"
     gene            1..942
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /note="taste receptor, type 2, member 201, tandem
                     duplicate 1"
                     /db_xref="GeneID:795929"
                     /db_xref="ZFIN:ZDB-GENE-070917-5"
     CDS             1..942
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /note="bitter taste receptor; taste receptor, type 2,
                     member 2a; zfT2R2a; taste receptor, type 2, member 201.1"
                     /codon_start=1
                     /product="taste receptor, type 2, member 201, tandem
                     duplicate 1"
                     /protein_id="NP_001077333.1"
                     /db_xref="GeneID:795929"
                     /db_xref="ZFIN:ZDB-GENE-070917-5"
                     /translation="

MGFFFVYISFLAYALVNVPVSIITILMNVFFVYCMFSSEKGQANSVKPPLNVLLWSLIGCSLLHNIFNLLFVLYELVYPPVWLYIISGATILFAMRTSFTACLGLQICYFLQIVPVRWPCFIWMKKHIKLFMYVLLFLDRLYFLSQYVIRVFLEIRRVVMSFNSSSVYDNTTSQSADFGYYMFIADFWLKCCYFFICLGIMLTSGITTVVYLWKHMKRMKENTSSLSALCKRQQMRVTIMGIIQTVLFFFASGWLMTEEFIECYFGGYDVGTHLASTVMALYSLGTTLLLGIGQSKFRLLAKDICKKTRKPKS"

     misc_feature    <202..>678
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:475119"
     misc_feature    253..321
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410628"
     misc_feature    400..459
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410628"
     misc_feature    544..618
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410628"
     exon            1..942
                     /gene="tas2r201.1"
                     /gene_synonym="T2R3a; tas2r2a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgggtttcttttttgtttacattagcttcttggcctatgccttagtcaatgtgccagtttctattatcactatcctgatgaacgtattttttgtgtactgtatgttttcttcagagaaaggacaagcaaacagtgtaaaaccgccgctgaatgttttgctgtggtcccttattggatgcagtcttcttcataacattttcaaccttttatttgttttgtatgaattagtttacccacctgtctggctgtacattatttcaggtgctactatacttttcgccatgaggacaagttttactgcatgcctcggtctgcaaatttgttacttcttgcagattgttccagtccgatggccttgctttatctggatgaagaagcacatcaaactcttcatgtacgtcttgttgtttctcgacagactctactttctgtctcaatatgtcatacgtgtttttcttgagattcggagggtagtgatgtcctttaattcatccagcgtttatgacaacaccaccagccagtcagcagatttcggatactacatgtttatcgcagacttttggctgaaatgttgctattttttcatttgtcttggcattatgctgacgtcaggcatcacgactgtcgtctacttgtggaagcacatgaagagaatgaaggagaacaccagctctttatctgctctttgtaaaaggcagcagatgagagtgaccatcatgggcatcattcagacggtcctcttcttctttgcttcagggtggctcatgactgaagagttcattgagtgttattttggtggttatgatgtgggcacccatttggcttctactgtaatggcactgtattctcttggaacgaccttacttttagggattggtcagtccaaattccgacttctggctaaggatatctgcaaaaagacaagaaaaccaaaatcctga

//