2024-06-15 04:36:13, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001083864 942 bp mRNA linear VRT 03-APR-2024 DEFINITION Danio rerio taste receptor, type 2, member 201, tandem duplicate 1 (tas2r201.1), mRNA. ACCESSION NM_001083864 XM_001336174 VERSION NM_001083864.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 942) AUTHORS Kowatschew,D. and Korsching,S.I. TITLE An Ancient Adenosine Receptor Gains Olfactory Function in Bony Vertebrates JOURNAL Genome Biol Evol 13 (9) (2021) PUBMED 34499158 REFERENCE 2 (bases 1 to 942) AUTHORS Behrens,M., Di Pizio,A., Redel,U., Meyerhof,W. and Korsching,S.I. TITLE At the Root of T2R Gene Evolution: Recognition Profiles of Coelacanth and Zebrafish Bitter Receptors JOURNAL Genome Biol Evol 13 (1) (2021) PUBMED 33355666 REFERENCE 3 (bases 1 to 942) AUTHORS Ohmoto,M., Okada,S., Nakamura,S., Abe,K. and Matsumoto,I. TITLE Mutually exclusive expression of Galphaia and Galpha14 reveals diversification of taste receptor cells in zebrafish JOURNAL J Comp Neurol 519 (8), 1616-1629 (2011) PUBMED 21452212 REFERENCE 4 (bases 1 to 942) AUTHORS Oike,H., Nagai,T., Furuyama,A., Okada,S., Aihara,Y., Ishimaru,Y., Marui,T., Matsumoto,I., Misaka,T. and Abe,K. TITLE Characterization of ligands for fish taste receptors JOURNAL J Neurosci 27 (21), 5584-5592 (2007) PUBMED 17522303 REFERENCE 5 (bases 1 to 942) AUTHORS Go,Y. CONSRTM SMBE Tri-National Young Investigators TITLE Proceedings of the SMBE Tri-National Young Investigators' Workshop 2005. Lineage-specific expansions and contractions of the bitter taste receptor gene repertoire in vertebrates JOURNAL Mol Biol Evol 23 (5), 964-972 (2006) PUBMED 16484289 REFERENCE 6 (bases 1 to 942) AUTHORS Ishimaru,Y., Okada,S., Naito,H., Nagai,T., Yasuoka,A., Matsumoto,I. and Abe,K. TITLE Two families of candidate taste receptors in fishes JOURNAL Mech Dev 122 (12), 1310-1321 (2005) PUBMED 16274966 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB249825.1. On Apr 5, 2007 this sequence version replaced XM_001336174.1. FEATURES Location/Qualifiers source 1..942 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="9" /map="9" gene 1..942 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /note="taste receptor, type 2, member 201, tandem duplicate 1" /db_xref="GeneID:795929" /db_xref="ZFIN:ZDB-GENE-070917-5" CDS 1..942 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /note="bitter taste receptor; taste receptor, type 2, member 2a; zfT2R2a; taste receptor, type 2, member 201.1" /codon_start=1 /product="taste receptor, type 2, member 201, tandem duplicate 1" /protein_id="NP_001077333.1" /db_xref="GeneID:795929" /db_xref="ZFIN:ZDB-GENE-070917-5" /translation="
MGFFFVYISFLAYALVNVPVSIITILMNVFFVYCMFSSEKGQANSVKPPLNVLLWSLIGCSLLHNIFNLLFVLYELVYPPVWLYIISGATILFAMRTSFTACLGLQICYFLQIVPVRWPCFIWMKKHIKLFMYVLLFLDRLYFLSQYVIRVFLEIRRVVMSFNSSSVYDNTTSQSADFGYYMFIADFWLKCCYFFICLGIMLTSGITTVVYLWKHMKRMKENTSSLSALCKRQQMRVTIMGIIQTVLFFFASGWLMTEEFIECYFGGYDVGTHLASTVMALYSLGTTLLLGIGQSKFRLLAKDICKKTRKPKS"
misc_feature <202..>678 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /note="seven-transmembrane G protein-coupled receptor superfamily; Region: 7tm_GPCRs; cl28897" /db_xref="CDD:475119" misc_feature 253..321 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:410628" misc_feature 400..459 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:410628" misc_feature 544..618 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:410628" exon 1..942 /gene="tas2r201.1" /gene_synonym="T2R3a; tas2r2a" /inference="alignment:Splign:2.1.0" ORIGIN
atgggtttcttttttgtttacattagcttcttggcctatgccttagtcaatgtgccagtttctattatcactatcctgatgaacgtattttttgtgtactgtatgttttcttcagagaaaggacaagcaaacagtgtaaaaccgccgctgaatgttttgctgtggtcccttattggatgcagtcttcttcataacattttcaaccttttatttgttttgtatgaattagtttacccacctgtctggctgtacattatttcaggtgctactatacttttcgccatgaggacaagttttactgcatgcctcggtctgcaaatttgttacttcttgcagattgttccagtccgatggccttgctttatctggatgaagaagcacatcaaactcttcatgtacgtcttgttgtttctcgacagactctactttctgtctcaatatgtcatacgtgtttttcttgagattcggagggtagtgatgtcctttaattcatccagcgtttatgacaacaccaccagccagtcagcagatttcggatactacatgtttatcgcagacttttggctgaaatgttgctattttttcatttgtcttggcattatgctgacgtcaggcatcacgactgtcgtctacttgtggaagcacatgaagagaatgaaggagaacaccagctctttatctgctctttgtaaaaggcagcagatgagagtgaccatcatgggcatcattcagacggtcctcttcttctttgcttcagggtggctcatgactgaagagttcattgagtgttattttggtggttatgatgtgggcacccatttggcttctactgtaatggcactgtattctcttggaacgaccttacttttagggattggtcagtccaaattccgacttctggctaaggatatctgcaaaaagacaagaaaaccaaaatcctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]