LOCUS       NM_001020665            1316 bp    mRNA    linear   VRT 14-MAR-2023
DEFINITION  Danio rerio protein tyrosine kinase 7a (ptk7a), mRNA.
ACCESSION   NM_001020665
VERSION     NM_001020665.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1316)
  AUTHORS   Wang J, Thomas HR, Thompson RG, Waldrep SC, Fogerty J, Song P, Li
            Z, Ma Y, Santra P, Hoover JD, Yeo NC, Drummond IA, Yoder BK, Amack
            JD, Perkins B and Parant JM.
  TITLE     Variable phenotypes and penetrance between and within different
            zebrafish ciliary transition zone mutants
  JOURNAL   Dis Model Mech 15 (12) (2022)
   PUBMED   36533556
REFERENCE   2  (bases 1 to 1316)
  AUTHORS   Meyer-Miner A, Van Gennip JLM, Henke K, Harris MP and Ciruna B.
  TITLE     Resolving primary pathomechanisms driving idiopathic-like spinal
            curvature using a new katnb1 scoliosis model
  JOURNAL   iScience 25 (9), 105028 (2022)
   PUBMED   36105588
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1316)
  AUTHORS   Van Gennip JLM, Boswell CW and Ciruna B.
  TITLE     Neuroinflammatory signals drive spinal curve formation in zebrafish
            models of idiopathic scoliosis
  JOURNAL   Sci Adv 4 (12), eaav1781 (2018)
   PUBMED   30547092
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1316)
  AUTHORS   Bayes A, Collins MO, Reig-Viader R, Gou G, Goulding D, Izquierdo A,
            Choudhary JS, Emes RD and Grant SG.
  TITLE     Evolution of complexity in the zebrafish synapse proteome
  JOURNAL   Nat Commun 8, 14613 (2017)
   PUBMED   28252024
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1316)
  AUTHORS   Boswell CW and Ciruna B.
  TITLE     Understanding Idiopathic Scoliosis: A New Zebrafish School of
            Thought
  JOURNAL   Trends Genet 33 (3), 183-196 (2017)
   PUBMED   28174019
  REMARK    Review article
REFERENCE   6  (bases 1 to 1316)
  AUTHORS   Nolte H, Holper S, Housley MP, Islam S, Piller T, Konzer A,
            Stainier DY, Braun T and Kruger M.
  TITLE     Dynamics of zebrafish fin regeneration using a pulsed SILAC
            approach
  JOURNAL   Proteomics 15 (4), 739-751 (2015)
   PUBMED   25504979
REFERENCE   7  (bases 1 to 1316)
  AUTHORS   Margarit E, Armas P, Garcia Siburu N and Calcaterra NB.
  TITLE     CNBP modulates the transcription of Wnt signaling pathway
            components
  JOURNAL   Biochim Biophys Acta 1839 (11), 1151-1160 (2014)
   PUBMED   25151948
REFERENCE   8  (bases 1 to 1316)
  AUTHORS   Hayes M, Gao X, Yu LX, Paria N, Henkelman RM, Wise CA and Ciruna B.
  TITLE     ptk7 mutant zebrafish models of congenital and idiopathic scoliosis
            implicate dysregulated Wnt signalling in disease
  JOURNAL   Nat Commun 5, 4777 (2014)
   PUBMED   25182715
  REMARK    GeneRIF: ptk7 mutant zebrafish models of congenital and idiopathic
            scoliosis implicate dysregulated Wnt signaling in disease.
            Publication Status: Online-Only
REFERENCE   9  (bases 1 to 1316)
  AUTHORS   Challa AK and Chatti K.
  TITLE     Conservation and early expression of zebrafish tyrosine kinases
            support the utility of zebrafish as a model for tyrosine kinase
            biology
  JOURNAL   Zebrafish 10 (3), 264-274 (2013)
   PUBMED   23234507
REFERENCE   10 (bases 1 to 1316)
  AUTHORS   Hayes M, Naito M, Daulat A, Angers S and Ciruna B.
  TITLE     Ptk7 promotes non-canonical Wnt/PCP-mediated morphogenesis and
            inhibits Wnt/beta-catenin-dependent cell fate decisions during
            vertebrate development
  JOURNAL   Development 140 (8), 1807-1818 (2013)
   PUBMED   23533179
  REMARK    Erratum:[Development. 2013 Apr;140(8):1807]
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC095690.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC095690.1, CO958720.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1316
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="22"
                     /map="22"
     gene            1..1316
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="protein tyrosine kinase 7a"
                     /db_xref="GeneID:553690"
                     /db_xref="ZFIN:ZDB-GENE-050522-216"
     exon            1..232
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    127..129
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="upstream in-frame stop codon"
     CDS             151..846
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /codon_start=1
                     /product="inactive tyrosine-protein kinase 7a"
                     /protein_id="NP_001018501.1"
                     /db_xref="GeneID:553690"
                     /db_xref="ZFIN:ZDB-GENE-050522-216"
                     /translation="

MGLWTRRRGRKLASAENVLLALTLIGEVIMAQAASFYFTKAPKSQDALHGRSAMLRCEVNDPQGVSYAWIQNGEPVTNSERRFLDGGNLKFTAIDRTLDSGNFQCIASKNSTGEEERTAETSFNIKWLESGAVSLKSPESVAEIQSSSQVILRCNIDGHPRPTNRWFKDGTQITEKNYKINNKERSLTLPNASPDDNGLYFCCAKNAAGQVCSSDNFTLNIIGLCVSLDSK"

     misc_feature    274..516
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:448366"
     misc_feature    307..321
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    343..360
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    409..423
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    454..471
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    547..816
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:448366"
     misc_feature    598..612
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    637..651
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    703..717
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    745..762
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    781..792
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     exon            233..529
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /inference="alignment:Splign:2.1.0"
     exon            530..632
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /inference="alignment:Splign:2.1.0"
     exon            633..1305
                     /gene="ptk7a"
                     /gene_synonym="zgc:112211"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gacgagcacgcgctcctgaaactctcgcggggacgagcagctaccaactggattttagcattcaaacaacagcccaacacttgcagtatttgtacatacaagaacttttaagcctttaatttattttaatcgcgttcatcgactttaaacatgggcttatggacgagaagacgcggacgcaaacttgcaagcgcggagaatgttttgctagcgctcactttgatcggcgaagtgattatggcacaggctgcctctttctacttcaccaaagcgccaaaatcccaggacgctctgcacgggcgcagtgccatgctgcggtgtgaagtaaacgacccccagggtgtttcctatgcctggatacaaaacggagagccggtcacaaactcagagcgccgctttctggacggcggaaacctgaagttcactgccatcgaccggacgctggattctggaaacttccaatgcatcgcctctaaaaacagcactggagaagaagagcgaacggccgagacctccttcaacatcaagtggttggaaagtggtgcggtgagtctgaagagtccagagtcagtggcagagattcagagctcctcacaagtgatactgcgctgcaacatagacggacacccacggccgaccaatcgctggtttaaagacgggactcaaataacagaaaaaaactacaaaatcaacaacaaagagcgaagccttacgctgccgaacgccagtcctgatgataacggcctctacttctgctgtgccaaaaacgcagcaggacaagtgtgcagcagcgacaacttcacactcaacattatcggtctgtgtgtttctcttgacagcaaataatgtggtcagacttaggcctgtcacaataaccaatatcaaatcaataggtttacagataaatgaaaaataaaaatattgacagtattatatatcgatgtaatgagccggtttaggcatttttagtgtgttttgaacaaacaaaaatcataaaactgatgtagttttcatctaaacaattcactttaattaatctaatcagtattgtatttaaattaaatcattttttaattttatgtttattttgaacataattgaggacagtcatacagcaattcaaggtatattggtatctcagtatgtgaacttaggtggcataaaagttacgtacattattgtcaggtgtatttactacacagtagtactcacattttgtaaattataaaatgaaaaacagcagaaagagagaagaaaaatacaaaataatgagagaaatataaaataaaatataataatcaaaaaaaaaaaaaaaa

//