LOCUS       NM_001005596            1177 bp    mRNA    linear   VRT 09-DEC-2023
DEFINITION  Danio rerio RNA binding fox-1 homolog 1 (rbfox1), mRNA.
ACCESSION   NM_001005596
VERSION     NM_001005596.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1177)
  AUTHORS   Ma J, Gu Y, Liu J, Song J, Zhou T, Jiang M, Wen Y, Guo X, Zhou Z,
            Sha J, He J, Hu Z, Luo L and Liu M.
  TITLE     Functional screening of congenital heart disease risk loci
            identifies 5 genes essential for heart development in zebrafish
  JOURNAL   Cell Mol Life Sci 80 (1), 19 (2022)
   PUBMED   36574072
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1177)
  AUTHORS   Giffen KP, Liu H, Kramer KL and He DZ.
  TITLE     Expression of Protein-Coding Gene Orthologs in Zebrafish and Mouse
            Inner Ear Non-sensory Supporting Cells
  JOURNAL   Front Neurosci 13, 1117 (2019)
   PUBMED   31680844
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1177)
  AUTHORS   Tai Z, Guan P, Wang Z, Li L, Zhang T, Li G and Liu JX.
  TITLE     Common responses of fish embryos to metals: an integrated analysis
            of transcriptomes and methylomes in zebrafish embryos under the
            stress of copper ions or silver nanoparticles
  JOURNAL   Metallomics 11 (9), 1452-1464 (2019)
   PUBMED   31468037
REFERENCE   4  (bases 1 to 1177)
  AUTHORS   Nikonova E, Kao SY, Ravichandran K, Wittner A and Spletter ML.
  TITLE     Conserved functions of RNA-binding proteins in muscle
  JOURNAL   Int J Biochem Cell Biol 110, 29-49 (2019)
   PUBMED   30818081
  REMARK    Review article
REFERENCE   5  (bases 1 to 1177)
  AUTHORS   Gao,C., Ren,S., Lee,J.H., Qiu,J., Chapski,D.J., Rau,C.D., Zhou,Y.,
            Abdellatif,M., Nakano,A., Vondriska,T.M., Xiao,X., Fu,X.D.,
            Chen,J.N. and Wang,Y.
  TITLE     RBFox1-mediated RNA splicing regulates cardiac hypertrophy and
            heart failure
  JOURNAL   J Clin Invest 126 (1), 195-206 (2016)
   PUBMED   26619120
REFERENCE   6  (bases 1 to 1177)
  AUTHORS   Frese KS, Meder B, Keller A, Just S, Haas J, Vogel B, Fischer S,
            Backes C, Matzas M, Kohler D, Benes V, Katus HA and Rottbauer W.
  TITLE     RNA splicing regulated by RBFOX1 is essential for cardiac function
            in zebrafish
  JOURNAL   J Cell Sci 128 (16), 3030-3040 (2015)
   PUBMED   26116573
  REMARK    GeneRIF: This study underlines that tightly regulated splicing is
            necessary for unconstrained cardiac function and renders the
            splicing regulator rbfox1 an interesting target for investigation
            in human heart failure and cardiomyopathy.
REFERENCE   7  (bases 1 to 1177)
  AUTHORS   Aoki M, Segawa H, Naito M and Okamoto H.
  TITLE     Identification of possible downstream genes required for the
            extension of peripheral axons in primary sensory neurons
  JOURNAL   Biochem Biophys Res Commun 445 (2), 357-362 (2014)
   PUBMED   24513284
REFERENCE   8  (bases 1 to 1177)
  AUTHORS   Amir-Zilberstein L, Blechman J, Sztainberg Y, Norton WH, Reuveny A,
            Borodovsky N, Tahor M, Bonkowsky JL, Bally-Cuif L, Chen A and
            Levkowitz G.
  TITLE     Homeodomain protein otp and activity-dependent splicing modulate
            neuronal adaptation to stress
  JOURNAL   Neuron 73 (2), 279-291 (2012)
   PUBMED   22284183
REFERENCE   9  (bases 1 to 1177)
  AUTHORS   Gallagher TL, Arribere JA, Geurts PA, Exner CR, McDonald KL, Dill
            KK, Marr HL, Adkar SS, Garnett AT, Amacher SL and Conboy JG.
  TITLE     Rbfox-regulated alternative splicing is critical for zebrafish
            cardiac and skeletal muscle functions
  JOURNAL   Dev Biol 359 (2), 251-261 (2011)
   PUBMED   21925157
REFERENCE   10 (bases 1 to 1177)
  AUTHORS   Kurrasch DM, Cheung CC, Lee FY, Tran PV, Hata K and Ingraham HA.
  TITLE     The neonatal ventromedial hypothalamus transcriptome reveals novel
            markers with spatially distinct patterning
  JOURNAL   J Neurosci 27 (50), 13624-13634 (2007)
   PUBMED   18077674
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC081500.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC081500.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1177
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..1177
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="RNA binding fox-1 homolog 1"
                     /db_xref="GeneID:449554"
                     /db_xref="ZFIN:ZDB-GENE-040927-11"
     exon            1..73
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    35..37
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="upstream in-frame stop codon"
     CDS             41..1162
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="fox-1 homolog A; ataxin-2-binding protein 1"
                     /codon_start=1
                     /product="RNA binding protein fox-1 homolog 1"
                     /protein_id="NP_001005596.1"
                     /db_xref="GeneID:449554"
                     /db_xref="ZFIN:ZDB-GENE-040927-11"
                     /translation="

MEEKGSKMVEQGNQDAPAPPETMAQPFPSAQFAPPQNGIPAEYTPSHPHPTPDYSGQTPVAEHTLNLYTPAQTHSEPSGPDNSIQAVSGTATQTDDSAQTDSQQQTQSSEITEIKTQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYANGWKLNPVVGAVYSPEFYAVPGFPYPAATAAAAAYRGAHLRGRGRTVYNTFRAAAPPPHIPAYGGVVYQDGFYGADIYGGYTAYRYTQPATATAAAYSDSYGRVYAADPYNHALAPAATYSVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYSRFAPY"

     misc_feature    41..394
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="propagated from UniProtKB/Swiss-Prot (Q642J5.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    395..622
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="RNA recognition motif (RRM) found in vertebrate RNA
                     binding protein fox-1 homologs and similar proteins;
                     Region: RRM_FOX1_like; cd12407"
                     /db_xref="CDD:409841"
     misc_feature    order(398..400,404..406,410..427,485..499,503..520,
                     524..526,596..598,611..622)
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:409841"
     misc_feature    398..400
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    422..424
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    425..427
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    497..499
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    512..514
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    524..526
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    596..598
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    626..628
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Interaction with RNA. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
                     site"
     misc_feature    722..994
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /note="Calcitonin gene-related peptide regulator C
                     terminal; Region: Fox-1_C; pfam12414"
                     /db_xref="CDD:432537"
     exon            74..316
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            317..460
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            461..514
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            515..607
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            608..668
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            669..722
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            723..858
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            859..898
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            899..963
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            964..1039
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
     exon            1040..1164
                     /gene="rbfox1"
                     /gene_synonym="a2bp1; fox1; zgc:103635"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agatgctgcagggattgggactaaggcagctgcttagtttatggaggaaaaagggagcaagatggtggaacagggtaatcaagacgccccagcacccccagaaaccatggcccagcctttcccatcggcccagttcgctccccctcagaacggcattcctgctgagtacacgccgtcccaccctcacccgaccccagactactcgggccagaccccggtggcagagcacacgctgaacttgtacacccctgcccaaacgcacagtgagcccagcggaccagacaacagcatacaggcggtctccggcacagccacacagacagacgattcagcacagacagacagccaacagcaaacacagtcatccgaaatcacagaaatcaaaacgcagcccaagaggctccacgtctccaacatccccttcaggttcagagatccagacctcaggcaaatgtttggccaatttggtaaaatcttagatgttgaaatcatatttaatgaacgaggatcaaagggttttggtttcgtaactttcgaaagtagtgccgatgcggacagggccagagagaaattacacggcacggtggtagaaggtcgtaaaatagaggttaacaatgcaacagcacgggtaatgacgaataaaaagacagtcaacccatatgcaaatggctggaagttgaatccagtcgtgggtgcagtctacagcccagaattctatgcagtgccaggcttcccatacccagcagccacggcggcagcggcggcgtacagaggggcacacttaagaggaagaggccgcaccgtctacaacacgtttcgggcagccgcgcctcccccacacatcccagcctatggaggtgttgtttaccaggacgggttttacggtgcagatatttatggtggttacactgcctaccgatacactcagcctgctactgctaccgccgctgcctacagtgacagttacggacgagtttatgctgccgacccctacaaccacgcacttgctccagcagccacatacagcgttggtgccatgaatgctttcgcacccttgactgatgccaagaccagaagccacgccgatgatgtgggtctcgttctttcttctttgcaggctagtatataccgaggtggatacagtcgtttcgcgccatattaaaaaaaaaaaaaaaaa

//