GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2023-11-29 15:24:05, GGRNA : RefSeq release 220 (Sep, 2023)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Telopea speciosissima uncharacterized LOC122670138 (LOC122670138), ncRNA. (148 bp)
alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:122670138" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC122670138" /product="uncharacterized LOC122670138" /db_xref="GeneID:122670138" ORIGIN // tttctacaagagatggtgtgcgaaacagtttttaatggaaaggaagaacttagtcaatctcttcttgaaagcaagcgaggaagacaagctgaaggtattggaattgtatatgccagatactgaggacatcaatgaagactgatgaatg
position 55
XR_006334132.1 - Telopea speciosissima - NCBI
PREDICTED: Citrus sinensis protein STRICTOSIDINE SYNTHASE-LIKE 4-like (LOC102608831), mRNA. (1352 bp)
agtgatttcaagctcatggctccgaagagtttcctgctagcttgtttacttgcttttactctacaattcttcttctcgcctccagtatcatcttcagcttctcttctttccacctccaaggaaagctcctctatgaaggatttgattaaacttggagaaggatgtgtgagccacccagaggatgtttctgttgtggttagaaagggtgcgctgtatacagctactaatgatggttgggtcaagtatttcatcctccataatgaaaccttggttaattggaagcacatagacagtcaatctcttcttggactcacagcaacaaaggaaggtgacgtcattatatgcgacagtaaaaaaggtttgtttaaggttaccgaagaaggcgtaaaggttcttgatccagatgtaagatttgcaaatgatgtgatcgatgcatcagatggcacgttgtattttactgtctcaagcaccaaatatacccccgcagatttctacaaagacatggctgagggaaatccttacggccagttgctcaaatatgatcctaaatcgaaccaaacaacagttttgcaagagggattttactttgctaatggcatt...
position 323
XM_006485118.4 - Citrus sinensis (sweet orange) - NCBI
PREDICTED: Citrus clementina protein STRICTOSIDINE SYNTHASE-LIKE 4 (LOC18050416), mRNA. (1112 bp)
agtgatttcaagctcatggctccgaagagtttcctgctagcttgtttacttgcttttactctacaattcttcttctcgcctccagtatcatcttcagcttctcttctttccacctccaaggaaagctcctctatgaaggatttgattaaacttggagaaggatgtgtgagccacccagaggatgtttctgttgtggttagaaagggtgcgctgtatacagctactaatgatggttgggtcaagtatttcatcctccataatgaaaccttggttaattggaagcacatagacagtcaatctcttcttggactcacagcaacaaaggaaggtgacgtcattatatgcgacagtaaaaaaggtttgtttaaggttaccgaagaaggcgtaaaggttcttgatccagatgtaagatttgcaaatgatgtgatcgatgcatcagatggcacgttgtattttactgtctcaagcaccaaatatacccccgcagatttctacaaagacatggctgagggaaatccttacggccagttgctcaaatatgatcctaaatcgaaccaaacaacagttttgcaagagggattttactttgctaatggcatt...
position 298
XM_006445687.2 - Citrus clementina - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X2, ncRNA. (319 bp)
GeneID:107512815" ncRNA 1..319 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X2" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacagcaaaacgacgccagacgccgttggtttgtgaacggccctcaccacgcggtggacgacgccccgcagaccggcgcccaaaccctgggagcctgcgaagacctcg
position 115
XR_001597394.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Camelus ferus uncharacterized LOC116657067 (LOC116657067), ncRNA. (330 bp)
gene="LOC116657067" /product="uncharacterized LOC116657067" /db_xref="GeneID:116657067" ORIGIN // accacatcacaaacaaaagtcctaataaaagtcgctgactaggactatcctcgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtacacatgaaagagatgtatttgctcagggtctatcaatcttgttctgcctgttttctcaagtcagcagccttatctttacatttactccactcaatctcttcttgtcattttccctttctgtctgaaaataactacccccaagtctgcaaagcatcatctttgtattccatttcttgttgtaaagagtttgtgacattctgcgagatggacatgctagatcggaagagca
position 193
XR_004311999.1 - Camelus ferus (Wild Bactrian camel) - NCBI
Caenorhabditis elegans Protein suex-1 (suex-1), mRNA. (413 bp)
org REFERENCE 4 (bases 1 to 413) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA aaatgcaatctcttcttgtattctgtcttgccacaattattctatcaaacttcacagaggcttctgcagatttggagacagcttcacaaagtctgaagcatccgaggaatttgggatggaaggctcctgaaggacatcgcgaaaaacgatatggtggatggggaggtggatatccctacggcggctacggtggatatggtggaggttacggtggcggatatggaggcggatacggaggagggtatggcggacgatatggcggaaactatggaagcagctcatggggatcatattcgagttatagttctggtggatacag...
position 6
NM_062648.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Penicillium citrinum uncharacterized protein (N7469_005960), partial mRNA. (414 bp)
Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgccttatgtagctgctacaattaaagaggctatgggatggagggcagttgttccgttggcttttccgcatgctactactcaagcgtctgtgactgacgttaatctccgtgatcagtacggttatggacccggtcgtcggattcgtcctgggatgcatcttgctgaacgcaatctcttcttggctatcgcgaaaatgagttgggtatttgatgtcggtactggtaatggtgaaaagacaaggttgcctattgaaccggatgttgatcatcagacgggatattgggagggcttgatcttgggtgctcggccattcccttgtcagatgtctgtgaggtctgaggcgagaagagatgccattgtgcgggaatttcagaagatgaattctgatatgttttcgagattcgcattttga
position 171
XM_056644879.1 - Penicillium citrinum - NCBI
Penicillium angulare uncharacterized protein (N7478_008204), partial mRNA. (438 bp)
JOURNAL Submitted (13-DEC-2022) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgcgcgccgctttgacgtgcagttgttcccatggattctatatggagaggaaaattgtgtacagcgttggtttgggatttatgattttcagcaaagtcagtctcaaaaagactgataggctcgtccttgacacggagattatcaatctcttcttgatcaatctcatcaccactgccaccatcgaagctctcagggatatggtagacaacgtcctcagagaagttgtaactcgcagaagtgtcattctcgcacgcaaaatcgtcaatgttgccaaaaacaacatcctcgttctcataatcaatgtccgattcagagacccccggggcctgctcaagaacgaattctggatcctcggggacggctgccttcttttgctgtggatgggatttcggttgagcagcagcagcagcagcagcagaagatggagcagactgtaa
position 144
XM_056924418.1 - Penicillium angulare - NCBI
PREDICTED: Telopea speciosissima uncharacterized LOC122662367 (LOC122662367), ncRNA. (304 bp)
product="uncharacterized LOC122662367" /db_xref="GeneID:122662367" ORIGIN // acagaacaaactcactcttactgaaaatcaagtttcgggggtgaatgtcttctcgcaaggtttctctggaaatcattttaaggggaaatcttctttccagaaacctgcttatagtttcctagagtccgtgctgccggggaaatcatcttcagcaaaaaccagttatttgcagggaagagagtggaaatgatatacgtggacatcttcaatctcttcttgtactaaatgtttctcaacaagagagacatgtgctgtaagcctgtaactgcgaagaattagatctcgaagggatctatttcgtttt
position 207
XR_006333008.1 - Telopea speciosissima - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X1, ncRNA. (409 bp)
GeneID:107512815" ncRNA 1..409 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X1" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacaggaaacctctccatgaaagaagaagaaaacaggtttttatcgaataagcagtaaaccagaacgtgacgtgcatccaggcaatccagtgggacatctcacctggacagagccagactggtgcgacctgtcacacacacgttctcgggatgagcaccagcttgtcttcaggtaagaggacttgacggcaccattta
position 115
XR_001597393.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Lontra canadensis late cornified envelope protein 1A-like (LOC116858788), mRNA. (414 bp)
ORIGIN // atggggcccaaggtccaaaacaggagctatgaggccttccaggtggcacttgccaaagagaatgaggcagaaaatcaaacttccgactccatcagcgagatgtcctaccagcagaatcagcagcagtgccagtcccctcccaagtgtcccaccccgaagtgccctccaaagtgtcccccaaagtgcccctcaatctcttcttgctgcagtgtcagctctgggggctgctgcagctccagctccgggggtagaagctgctgcagttttggaggtggcagctcctgcctgagccaccacagacgacacaggtcccactgtcacagatgccagagctctggctgctgcagccagccctcagggggctccagctgctgtggagggggcagcagtcagtcctctggaggctgttgctga
position 191
XM_032843692.1 - Lontra canadensis (Northern American river otter) - NCBI
Penicillium crustosum uncharacterized protein (N7487_009046), partial mRNA. (531 bp)
JOURNAL Submitted (30-NOV-2022) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgcaggatatctacactaagatggatacaatggtagcggtgattctaacagacgtaaactttatgacaaacacaccgataattaccgatcaagcggacgagcaggaggtctatgagggatactcaaattttgtacaatctcttcttgagctcatggacgccgtatcgagcagcgcagcccagctgaaatcgatcaacgaaacaaccaagaataacgttccctttggaattcgcatcttgcaaactgccgttgacgtgagttccctaattaactcttcgctaccacctgaggagatgatcgatgagatgctgacaccttacaaggcctacttctacaacatcatcggtctcttcccagccaacagcgcatacaacgcccaggccaacaaccagaaggctcaggtggatacgcattgcttccaggccgtctgggcatttgatcgcaggtat...
position 136
XM_056876776.1 - Penicillium crustosum - NCBI
Penicillium brevicompactum uncharacterized protein (N7506_009931), partial mRNA. (537 bp)
Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atggcagcctcgttgtcttcgtcggttacatcgctgcagtcatcgctgcagctgctggataattcaataaccaccctcgactcgggcgtgagcgactttcctcgcctttgtaaggtcctttctacaacgcgacattttgagctactaccagagccaacactgcgtgaggcacaacaatctcttcttgatgagatcacccccagcatcgcccatcttctcacactatcatcaaaccacgtcgaaaagctcgcacgccgtgaggaaagcttaaaagcaaaatgcgatcttcaagaaggaagactctcatctaatgcagagagccgcccatctgctcctcgcagtcaaccccagagcagcgcattgcggggtcgcatggcggggtctagcgctggctcatcgggcagcgcagcagccaaagccgcagaatacaagagactcgtacagaagaaagagcgactcaagtttgcggttgaccgattgga...
position 175
XM_056959224.1 - Penicillium brevicompactum - NCBI
PREDICTED: Cygnus olor uncharacterized LOC121066939 (LOC121066939), ncRNA. (369 bp)
LOC121066939" /db_xref="GeneID:121066939" ORIGIN // agacacacctgatgatttattattttcagtagcttatttgtgaatatgaaaaaatgtctttcttgatattcaccaaatgatataaatgcctttactctccagctcttcattttttctgctcactggtgctttgaatgcagtggaaaggcatttctggtctccatggcttctcttaaatgcacgcagagaagggaacataatagagatgatgagccctagcaaattagccaactgcaatctcttcttgttcagttaacgcgcctgtacagccagataccagccacgggagcaaagggctgtgagaggagatttggagcccaagtataggagtagagaagctctcagctgtttgtagcatgtctagaagca
position 235
XR_005818030.1 - Cygnus olor (mute swan) - NCBI
Laccaria bicolor S238N-H82 hypothetical protein partial mRNA. (411 bp)
Wuyts,J., Martin,F. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagc...
position 61
XM_001879458.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Prosopis cineraria uncharacterized LOC129311497 (LOC129311497), mRNA. (565 bp)
pfam09402" /db_xref="CDD:430586" ORIGIN // aacagcagcaaacaagggtgccgtaaaaggcggtctgagcatcccgctcggccggacacatcactctgatctcttccaaatgaagcgcgcaaaacccaagtcccattccaaaacttcaaatcattctcacaattcttctccttctttgaaatcgttcatagaaccccctcctgatttctttccctcgaagcacgagttcctcaggctcatcgtcgtccttgcattcgcatcagcagttgcttggacatgcaatctcttcttgacatcttttattaatccctccaccaagcccttttgcgatagcaacgtagactttccggattcattttccgatgattgtgaaccttgtccaagtaatggagcatgttacgatggcaaattggaatgtctccagggctaccgaaagcatgggaagttgtgtgtagaagatggagatattaataaatcagctaaaaaaatttcggacagagtaaaatgtagcctatgtgaagattatgctcagtatttgtgctatggagtcggatcagtttgggttcaagaggatgaaatatggaaaa...
position 250
XM_054953827.1 - Prosopis cineraria - NCBI
PREDICTED: Podarcis raffonei uncharacterized LOC128424167 (LOC128424167), ncRNA. (394 bp)
experiment="COORDINATES: polyA evidence [ECO:0006239]" /db_xref="GeneID:128424167" ORIGIN // ggtggggagagaaggagactctcctgagggcaacagtgagagaagggaacttgccagtggcccatctagtcctggatcctgttctcacagtggccaacaggcatcaatttacacttatttacattgtttatgttgaattgcacttgccattttattacccattcactcaggttggagagcttgttttcacaatctcttcttgtttgaatgaccctgaacaatttagcatcatcggcaaacttcactgctcacccctaattctcaattgtttttgaacaagttaaatagcagaggtctcagtgttgatctttttaaaataaaaaataaaataaggtgttgttaaagttttttcataatacaataagataaaagaaactaaataaaaacaaaaaca
position 190
XR_008332942.1 - Podarcis raffonei (Aeolian wall lizard) - NCBI
PREDICTED: Drosophila subpulchrella uncharacterized LOC119551309 (LOC119551309), mRNA. (513 bp)
tgcatagagctgaagtgcttctgcatcctgatagccatcgtggaggtgctcatccgcgggttggatcgtttttttgtggatcgcgacagcatcctgggatttttgtccctcgtggtgagcggtatctacgtaatctgctgcatattccttcttcttggagccgtgctgggggtaaggtactttctgttgccctacctctcggtttcctgcctccgcttccttattttggttgccgagggcgtgtttgtggccacggaaggcttcgtcaatgaatatcttgtcttcgatgttctccaatctcttcttggtctatacttttggctggtggtcttctcctactacgatctgttgaaggacacctgagtttatatatttgtgcttacttttatattgtaaaaaatacttgtttagatctgagt
position 389
XM_037860603.1 - Drosophila subpulchrella - NCBI
Trematosphaeria pertusa uncharacterized protein (BU26DRAFT_500137), partial mRNA. (528 bp)
CA 94598-1698, USA atgaccgacaccgcggactttgagcaattttgcttaactacactctacaatgctattccgatgctcgacaaccccagcgaccggtacgagtggaataatagggtgtgcgattttattgagatttcctctgtcgccgaagatggtgctcctccaccaaacaaagatcaggcaaaggaatggtatcgccgacagaaactctacacagccatgatcatgaagaagctgtcgcacaacgctgcgccgcgaattaaggccttagggatcagtgacgtgcaatctcttcttgaagctgtgcgagagcgcttcaactttagccgcctcaaggacgaggcaatcgaggaagagtaccgatccggccagcggggcaatgagccggcgaaggcgcagcgtgttagcaaccagattcaaactcttacccgccagatattgatatcaccggacgaaaccagatgccagattcacatagacaaggttccgttttgctcattttgtcccaccaaactcgcacagcaacccagaaacatttag
position 274
XM_033826478.1 - Trematosphaeria pertusa - NCBI
PREDICTED: Beta vulgaris subsp. vulgaris uncharacterized mitochondrial protein AtMg00310-like (LOC130591735), mRNA. (381 bp)
ORIGIN // atgaaagaagctgcaagggtggaaagagaaattgctatccaccccgggaaagaggtgcttattaaattagtggcgcaagctattcccacgtatatgatgagtgtattcagccttcctagcggattgattgatgagattcattcgttgctggctcgattttggtgggggtcctctgacactgataggaagatgcattggcatagttgggatacgttgtgctaccccaaatcgatgggcggtcttggctttagggacctacactgcttcaaccaatctcttcttgcaaagcaagcatggcggttatgtacgggggaccagactcttctttatcggctgctgcaagcacgatactttaagtcttcggaatttctggaggcgtga
position 271
XM_057395547.1 - Beta vulgaris subsp. vulgaris - NCBI
PREDICTED: Raphanus sativus precursor of CEP15-like (LOC108835208), mRNA. (657 bp)
polyA_site 657 /gene="LOC108835208" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN // tcaacaaagttggccctccaaaattttttataattcaatgtttctttcttatatagttatttaaatatgctcattatattgtaaacaacaccacacaatctcttcttggaccctaaagacatcaagaagaaagaagatccgtatatacaaattctcttatttttaccatttgattgtgttcttaaaaggtttcttcgcgatatggatgaaatgaagattaagcttcacgttttgttactctatttcttactcatctccgcagttccttcggttctcgggttcaaaatgagaggcactactactagatctgagccgggagcatttctcggcggagaatacttaccggcgatgaagagcaggaagttgatggtcacaaacatggaagttgattattcaggtgactattatgatggagcctcttcagcatcaccgtcaccacctttgcctgattatgatgatgatatctataaaaggcaaggtgatgtcccaagccccggt...
position 96
XM_018608490.2 - Raphanus sativus (radish) - NCBI
PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles complex 1 subunit 3-like (LOC124274838), transcript variant X2, mRNA. (1880 bp)
aatcttcagttccacagtcacctggtgagtctggggagccacgcctacatgtctgctgccaagcacatcaacaacaccacacagcagctgctcaagtcacatgttgctatccaggacgtgtctcacaacatgaggctgatgaccaacgacctgttccgcctggaggacaagatcaacattatctcctcctgtagcctgttacctgacatcaacatagaactgtcgtcatagcaacaccatctcctcctatgacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacaccatctcttcttgtaacctgttgcttgacatcaacgcagaactgtcatcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaagaccatctcctcctgtta...
position 649
XM_046710202.1 - Haliotis rubra (blacklip abalone) - NCBI
PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles complex 1 subunit 3-like (LOC124274838), transcript variant X1, mRNA. (1893 bp)
aatcttcagttccacagtcacctggtgagtctggggagccacgcctacatgtctgctgccaagcacatcaacaacaccacacagcagctgctcaagtcacatgttgctatccaggacgtgtctcacaacatgaggctgatgaccaacgacctgttccgcctggaggacaagatcaacattatctcctcctgtagcctgttacctgacatcaacatagaactgtcgtcatagcaacaccatctcctcctatgacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacaccatctcttcttgtaacctgttgcttgacatcaacgcagaactgtcatcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaagaccatctcctcctgtta...
position 662
XM_046710201.1 - Haliotis rubra (blacklip abalone) - NCBI
PREDICTED: Fukomys damarensis uncharacterized LOC104847975 (LOC104847975), ncRNA. (576 bp)
RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:104847975" ncRNA 1..576 /ncRNA_class="lncRNA" /gene="LOC104847975" /product="uncharacterized LOC104847975" /db_xref="GeneID:104847975" ORIGIN // ctggtgaatggaggctgacttcttgctctccaagaactgcaagtagctacccaatctcttcttgaaatcagcagtctgtgagctcactgtagtggggcagccagaaccttaaagcctaacaatgggacagtgacaagaagagaggtggagagaaactttcacagtccccctcttccactccaagagaagaaacacacggctttattatggtaccaagtccacctccagatagaagcaatacatctcctcttgaacaagactgtttctccagtttaagcaaatctatccaaactacctccaagctgcagtgaatcatacggtggctgaaggaactacactaagaaggacttgaaagactt...
position 52
XR_776269.2 - Fukomys damarensis (Damara mole-rat) - NCBI
PREDICTED: Arabidopsis lyrata subsp. lyrata ubiquitin-conjugating enzyme E2 36-like (LOC110230388), mRNA. (391 bp)
gtgattttagacattgggaaatggtggaatcatatgagcagcatggtgatgaaaatgatgggcatgttccatatgtaccttctggtgacagaattatggaggatatgcgggattctatcactacagagatggctgaaggaacgagacttccatattaacagctcccggtatttcaatgttatgattcttggacctacacaatcaccttatgaaggagttgggtttgaatcgagaagcaaatacttgtttggtaaagtctctatctagattaagcaaatcgaggaacaaaaccaatctcttcttgctctgttttaagacactgctttgattattatgtccctaatcttacattatgaatgtatttcactaaagcagtgacattggttggttt
position 292
XM_021033133.1 - Arabidopsis lyrata subsp. lyrata - NCBI
PREDICTED: Syngnathus acus prefoldin 5 (pfdn5), mRNA. (612 bp)
gttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagatttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaattgtgacaacacttaaatgaatgctttttgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttagtgaacattaa
position 566
XM_037252075.1 - Syngnathus acus (greater pipefish) - NCBI
PREDICTED: Prosopis cineraria chitin-binding lectin 1-like (LOC129284393), mRNA. (726 bp)
id="XP_054775833.1" /db_xref="GeneID:129284393" /translation="MTKKVTTMKLHVNLQCVKCYKKVKNVLCKFPQIQDQKFDEKENIVTIKVVCCSPEKIMDQLCRKGCGAIKCIEKVPCKPPTLPPTLCCDSCCECWHDGPCFEPKPRVPDRTCCVPCHDGRPCRPCFERCCRPPPCYEGYFYARPVYDSYGGGQPCYVSRCGQYVSEDNVTGCTIM" ORIGIN // tctttgctttcttccacaccattaccgttattgtcactttcaatctcttcttgcatcattttcatctctcgcatatctgagctcgatttcctcgtcattcagccatgactaaaaaggtgacaacaatgaagctccatgttaatctccagtgtgtgaaatgctacaagaaggtcaagaatgttctctgtaaattcccacaaattcaagaccagaaattcgatgagaaggagaacattgtgacgattaaagtggtgtgctgtagcccagagaagattatggatcagctttgccgtaaaggttgtggcgccattaagtgcatcgaaaaagtcccatgtaagccaccaactctgc...
position 41
XM_054919858.1 - Prosopis cineraria - NCBI
Meira miltonrushii Isochorismatase hydrolase (FA14DRAFT_152158), partial mRNA. (618 bp)
caaaacttttgaggggcgctcaaatcttggagatcccagttttcacaactgaacaaaactcgaaagctcttggatcgacggtagacgttctcaagaaagatatcccagaaaattccacaatcgttgacaagacccgattcagtatggtattggacgatggaacaacagataaatggctacgcgatcacaaagttcaaaatgtgatgattgtcggaattgagagtcacgtatgcgtcttacaaacgacattggacttgctcaagaaaggcttcaacgttttcatcattcgtgatgcaatctcttcttgtaataaacaagaagttccacttgccatcgaaagaatgcgtttggctggcgctacaatcacaacatccgaaagcgctctgtttgaactgatgctagattcaaaacatccccatttcaaagctatcagtgggctaatcaagacggaaaaggacagtacaaaagccgctcttgaagcactcacatcacgtatttga
position 413
XM_025497511.1 - Meira miltonrushii - NCBI
Arabidopsis thaliana uncharacterized protein (AT2G18970), mRNA. (531 bp)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA tccaatctcactcaaaatctcctccatgttcatctcttctccacctggcaaaagcttctgcaattccttcaatctcttcttgatctctcctccttcttcttcttcgtcgctgtcttggtgtttttctccaccttgtctcttgctcgatctttctagaatctcggaaggagaactactagtgctaattggatcatcataaggggaagataatagcttctgttgcaagaaacggctccacgcgaattcttgagcagacaatgcgaaagccatgtctacttcatgtttcacgggttcttgtttggttggagagaaaagactcgctttctcttgtttataatttgcctctccatgtgaaatttgtttgcttcgtcggaactct...
position 70
Synonym: F19F24.17; F19F24_17
NM_127454.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Herrania umbratica uncharacterized LOC110427542 (LOC110427542), mRNA. (417 bp)
misc_feature 144 /gene="LOC110427542" /note="gag-polypeptide of LTR copia-type; Region: Retrotran_gag_2; pfam14223" /db_xref="CDD:433786" ORIGIN // atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag
position 115
XM_021443097.1 - Herrania umbratica - NCBI
Brettanomyces bruxellensis uncharacterized protein (BRETT_000934), partial mRNA. (543 bp)
Research, Australian Wine Research Institute, Corner of Hartley Grove and Paratoo Road, Urrbrae, SA 5064, Australia atggttgcataccaatttagttccgtttgtgagaattgtgaactaaatgtgaacatgagtgactcagataaaacagacaagaaatttccacgctcttctctttccagaacaactacaacgactagcataactacccctgttcacccaatggaattggttgtacaatctcttcttgaatcacctcttgagcttctaaatttgagtattcattcattgtatgaatcgcaaatgattctcacaacaatattagatcgaatgcagcggaaacttgacaaatgtcttaggggcattggtaaaagtaggcaagaaccaattactactgacacagatacgcaaaatttacaatatccaaacgagcatcgaaatagggcaaactcagatgatgatctgacaacacagccaggaccagacaaaagcttgacaattgaagaatatgctgccagaattcatacgatcaagctccgcattgtaaaa...
position 163
XM_041279492.1 - Brettanomyces bruxellensis - NCBI
PREDICTED: Acropora digitifera uncharacterized LOC107337268 (LOC107337268), ncRNA. (444 bp)
including 41 samples with support for all annotated introns" /db_xref="GeneID:107337268" ncRNA 1..444 /ncRNA_class="lncRNA" /gene="LOC107337268" /product="uncharacterized LOC107337268" /db_xref="GeneID:107337268" ORIGIN // cagaatgggtgttcctcttgtggttttgcttgaattctgttctgagggtgataacgtcttgatgccgtcaatctcttcttgtctgctaatgagtggctcaaatttgttcccacgaaagaggtggaaaatccgttctttggacaaacaagtaattttgggattccagcatcttggtctttaatgtttggatcaccaatgcattggcatggaaacctattttagtgaggcagactcatgagttatgtacttaccataactttcacgtttgtttgatcactgttttgcgcttagtttagcaaggaacctctccatgttacgggtcattatttgtagtatttgctcaaaacgttaccatgaaacagctaccacgtgtcaaa...
position 69
XR_001562778.1 - Acropora digitifera - NCBI
PREDICTED: Ahaetulla prasina mucin-2-like (LOC131184643), transcript variant X4, mRNA. (456 bp)
gcggcggctgctgctgctgctgcttctcccaggggcgctgctgagcttcctcccgcaggcgaccccgcacccgagtgtgacacaccgttacgaaaatgttaaagcagtggagatatctgtgcagccaactgcagttgaagaggttatatcgggagggaaagatgctgttgaagtccagcatcaatctaaaaagaagaaaaatgacattatagagttgaaagagaccttggaggtcttctagtccaaatccctgctcaagcaggagatcctatccattctggacaaattactatccaatctcttcttgaaaagttccaa
position 433
XM_058156240.1 - Ahaetulla prasina - NCBI
PREDICTED: Rhodamnia argentea U-box domain-containing protein 7-like (LOC115752846), mRNA. (560 bp)
ttcctcaggaacaaggagttgatattagctgccggagtcgttccgcttctccaggaaatgacatccaaccatgactctcatccatcagcaacggctctatatctgaatctttcctgccttgaagatgccaagcccgtactaggcttgagtcaggctgtaccctttcttacccagcttcttaaagatgaaactgcacctcagtgcaagcttgatgctattcacgccctttacaatctctccacctaccatgacaatattggatacctgccttcggcaggcattatcagtggccttcaatctcttcttgcagatctagtgaccaaatgtggacagaaaagtcaatagctgtccttatgaatttagat
position 490
XM_048275127.1 - Rhodamnia argentea - NCBI
Penicillium diatomitis uncharacterized protein (N7539_001235), partial mRNA. (759 bp)
gaagttcgccatcgagggtagtaacttggcaatcaactacctctctagccgagagcaagccgaagagctggccgagaaattggcccggaagtacggcgtaaaagcagttaccatccaaggggatgctggcattgcgcaagactgtgtacggctagtgcaagatacgattcagcggctgaatggcctagacgttgtcatctccaacgctggatggacgaagttcactgagtttggagatctcgaggctatgaatgaagatgaatgggaccggtgttggaccacgaatgtcaaaagcaatctcttcttgttcaaagaggcctctccaactttcaatgcaaaccctgacggaggtgtcttcattgcaacctcctccattgcgggtatcatgccgggtggaagtagcatggcttattccgtcaccaagtctgccggattacatctcctacagtgtctcaaggccagtcaagggccaaaggtccggataaatgccgtgctgccaggtctacttctgaccgactggggcgctcgattctccgatgagcaaatcacggcgtggaaagagaggtctaccttgaaacatgaagtcttcctcgacgattg...
position 369
XM_056930839.1 - Penicillium diatomitis - NCBI
PREDICTED: Raphanus sativus precursor of CEP15-like (LOC108846357), mRNA. (767 bp)
translation="MDTMKIIKLHVILVSFLLIFEVPSILGFSMRGTTRSEPEAFHGREYFSAMKSRKLMVTNLQVDYSADYDDGASSSASPSPPVPDYDDDINKRQGDVPSPAIGH" polyA_site 767 /gene="LOC108846357" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN // caatgtttctttttatacagttatctatatatatgcattattgtatgaacaacaacaccacaatctcttcttggatcctaaacataacaagaagaaagaacacagatacgaattctcttattttcaccatttaatttgattgttttcttgaataggtatatagagctactagaaatggatacaatgaagattattaaacttcacgttatactagtctctttcttactcatctttgaagttccttcgattcttgggttcagtatgagaggcactactagatcggagccggaagcatttcacggcagagagtacttctcggcgatgaagagcaggaagttgatggttacaaacttgcaagtcgattattcagctgattatga...
position 61
XM_018619590.2 - Raphanus sativus (radish) - NCBI
Penicillium nucicola Glucose/ribitol dehydrogenase (N7511_005191), partial mRNA. (774 bp)
Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 774) AUTHORS Petersen,C. TITLE Direct Submission JOURNAL Submitted (11-JAN-2023) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgccctcaatttccggtcaatctcttcttgtcattggcggttcgtccggcattggcgccagcgtcgcccaactcgccgtggaacaaggcgtgcgcgtctccatcgcgtcgtccaaccccgctcgcgtagccaatgccgtcgccaagattagatcccagtccccagaaacgatccccaacactcaaatcaggggcttcactattgaccttgcccagccggatgtcgagcagcgcctcgaacagctcttggccgacgccacagccgatgcctccgagcttctcgaccacatcgtcgtcacggccggcaaaccggcaacgcggccacttgccagcac...
position 19
XM_057127568.1 - Penicillium nucicola - NCBI
Penicillium chrysogenum uncharacterized protein (N7489_009227), partial mRNA. (774 bp)
gctcaatgccaacatcgccctctgctcctcacaagcccttttagtcccatactcatcatggcacgtaccccgatatcacgaatggatgaaagatccggaaatccaagaagcaacagcctcagaacccctaactctagaagaagaatactcgatgcaacgcagctggcgccaagacgccgacaaattaactttcattgtctgtcgagcgatcacaacaggcactgaagatgaaatccccagccagaggaaactgcaagcagaaagtgactcaccggctaccatggtcggcgacatcaatctcttcttgcgcatcgacgacggcgaggagggagacagcccgccgcagatagtcggcgaggtcgagctcatgatcgctgagaaagtcaaccagcgacgtgggtttgggcgtgctgctctactcatgttcatgcgatatattgttcagaaccagggggctattctagatgagtttgttagtggtggcgatgttggtgttaagactgtgcggaagttgcggactggtgttgagacgacggggtcatcggagggactggcacttgaatatctcagtgttaagattggacaaacgaacttgaggag...
position 300
XM_056714977.1 - Penicillium chrysogenum - NCBI
PREDICTED: Eublepharis macularius taste receptor type 2 member 40-like (LOC129323927), mRNA. (774 bp)
db_xref="CDD:410628" misc_feature 496..561 /gene="LOC129323927" /note="TM helix 6 [structural motif]; Region: TM helix 6" /db_xref="CDD:410628" misc_feature 595..672 /gene="LOC129323927" /note="TM helix 7 [structural motif]; Region: TM helix 7" /db_xref="CDD:410628" ORIGIN // atggtctggatgtcaatctcttcttgggcctttgaagtgacagttgtgtaccaaacgttcaaagctgtcatctggcttctcacgtgtatcagtttctgcttctcgtcctgcctgtgttcattttactgtataaaaatcgctaacttcaagcaccatctgttcattcgtctgaagatgggcatctccaggttggtgccctggatgctcctgggttctgtgtttggatcgctggcaaacacttacccattttatcgtgacatttatcgtataacttgcaaaaacaatacaatttccagtgctttaggaaaccaaacacgtgaaga...
position 14
XM_054970772.1 - Eublepharis macularius - NCBI
Aspergillus piperis CBS 112811 hypothetical protein (BO85DRAFT_383017), partial mRNA. (453 bp)
gtcttaaagctcatcgaatccaccaccatggatttccgcaacctatcattcactctcctcctgctatccactacagtcatgttatatttcagggctctattagcgcatcccatccacattattagcacccctgaatcagtgcagactgcagaaccagcgccaaccgacgccctcgccttcctcgacgagcccgtcttcaaaccactggcatctcacatagcagaccacccatatccatggcgtgataaacgtccattccaggagaccaattatgcgttactcatgggtgcagttcaatctcttcttgaggctgaggttgacgaggaagagggtggtgtgggtttgaacgagggtcatgggcaacaggacgtcgttgagattaactcgtctgagacatacattctctgggttggggataaggatgatgagaagtgttcttgcgcttag
position 301
XM_025656494.1 - Aspergillus piperis CBS 112811 - NCBI
PREDICTED: Manis pentadactyla uncharacterized LOC118908090 (LOC118908090), ncRNA. (484 bp)
ggcctcttatccacgtctgcagaaaaatcactcacgggatttgacatctgctgcacaccatggagaagacaccttattgatgaaaaagaacacagttcctgaggattgctctgggatggggaaaacttgatcatcttctgccccttgtgctcacagaaactgtttgaggtctgtctcctggggaccccaccctccatttttaggactgaatacctgaagtacagttgtcatcctgttgaatcttatgttacctgcattttatgtcttcaacttctctggttttgtttaagcaaacaatctcttcttgagaagggacagaagggaaataaaattctagatacccaatgtgtccaaaaa
position 422
XR_008998512.1 - Manis pentadactyla (Chinese pangolin) - NCBI
Rhizoctonia solani Lytic polysaccharide mono-oxygenase, cellulose-degrading (RhiXN_09028), partial mRNA. (567 bp)
China Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China atgcgcttcctggctggtttattgactttggcgactttggcgtcgtccgttgtcgctcatggcattgtaactcaacctccaactcgcacactcgggagtgccatgattgcagcttgcggtgaaggtgctgtctcggctcaaaaatccaatgtcaagggaccgattgaaagccagattgccaagattgattccaactacaagcccgcgcaatgcaatctcttcttgtgccgtggccaacagtttgctgacaacaaggacaaagtccaaacctacaagactggtcaagtcgtgaacattgtactagacattgagaaccaccatcctgttggctatgcaaacgtatctgttatcgatactgccacaaacaagatggttggcaagcctctgattgcatgggatccttactttactggttatccgtaccctaaggatcaagagaacttcaacgtcactattccagagctcagcggcaaatgcaagactgccggagaatgtgttctacaataccactggtactcccgaacgg...
position 213
XM_043328844.1 - Rhizoctonia solani - NCBI
Bipolaris victoriae FI3 hypothetical protein partial mRNA. (792 bp)
K., Schmutz,J., Baker,S., Ciuffetti,L.M., Grigoriev,I.V., Zhong,S., Nordberg,B.G., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (28-JAN-2014) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atgaggttccaatctcttcttgcgttcccagtctctcttgcacttctttggagtgctgctggcccgtttaccaatgcagcacccgctcctctgcctcctgatgccgttacaacgaacattcagcttcctagacagattgagcatgttctgtacggttcagacgtcgaagatgtcaatgtcaccaccaatcatctcgttcgccgcggttgctttcccagcaaagaagaagaagacgatataggccccacgacatgcgatggtagcgttcctccgctcgatgaattgcgagctcagatccagcgctggggccaagtagctg...
position 10
XM_014696645.1 - Bipolaris victoriae FI3 - NCBI
Puccinia striiformis f. sp. tritici uncharacterized protein (Pst134EA_002690), partial mRNA. (597 bp)
ggcacacatcttcaacgacaccaagttcttcagtcaacttgagctcggcaatcacgatgttatccagacggggaagaaagacgcaactctccccatcgaaggcactggaagggtaaccttacaatggagcacctctacagttttgctagacaactgcctctacgttccagatattgtaatcaatctcattagtgctggtgctctgctagaaaaaggttgccaaatcgttgcaaagaaaggtagctttactgtctccaaagaacagcaagatctcttcaaaggctccatcgatagcaatctcttcttggtcgataatttgtatgcaatcatctaa
position 558
XM_047941149.1 - Puccinia striiformis f. sp. tritici - NCBI
PREDICTED: Bos mutus transmembrane BAX inhibitor motif containing 4 (TMBIM4), transcript variant X4, mRNA. (800 bp)
gccttcgttgttactttctatgatgtgtatgttgtcctgcaagctttcatactgacttgtgcagtatttcttggtttgactgtatatactttacagtctaagagagatttcagcaaatttggagcagggaatcttgaggttgtttttttacagtgagacagtggagttggtcttggctgctgggggagcccttcttttctgcggattcatcatctatgacacacactcactgatgcacaggctgtcacctgaagagtatgtattagctgccatcaacctctacttggatatcatcaatctcttcttgcacctgttacgggttttggaagcagctaataaaaagtgattgaaagca
position 740
XM_005910356.2 - Bos mutus (wild yak) - NCBI
Bipolaris victoriae FI3 hypothetical protein partial mRNA. (801 bp)
accgcctcgctaccagcgatccacaccacgcagtaacagcttcagcaatcaagactactccccgttcaacggcagtcctcgcccaaatctgggagggtcaacctccaattctcccttcaatctcagcggatcagcagcaaagcgtttgagctacaacagttcaatgagcagcagtctgtttggtgacagctcgagcagcgtgaccccgggtactcccacaccatcgaccggcaaggccagcgtgggactgaacaacaagtggctatacgagaagcgaagggacagccccaagagcaatctcttcttgtga
position 786
XM_014703279.1 - Bipolaris victoriae FI3 - NCBI
PREDICTED: Raphanus sativus HVA22-like protein d (LOC130510523), mRNA. (809 bp)
ORIGIN // agcctcaacaatttcgcagagttgtctctctgtttctctcactcttccagattttagtagcttctgaattttattttattttataagagaaaaatgaccaagttctggactttactcactgctcttcatacaggcgctgggcctgtggtgatgttagtatatccactgtacgcatcggtggtagctatggagaccgcaacgaaagtagacgatgaacagtggctatcctactggatcatatactcgttcctgacgctcacggagctgattctacaatctcttcttgagtggattcctatttggtactcggtcaaacttgtgttcgtcgcttggttggttctgcctcagttccatggagctgctttcatctacaacagtttggtgagagaacagttcaagaaacacggcgtcttctctcaccaacagtcaaagcccaccaaacccaagatccttaactccattttcccccaccgggagggacacgaggctcactctcactgacacaagaaaaaaaaaaggaagaaagcttgactggtattgtaatggagttggtagtggtcccatcttgactaatcttacgttttactttt...
position 274
XM_057006913.1 - Raphanus sativus (radish) - NCBI
PREDICTED: Lingula anatina protein FAM84B-like (LOC106176727), mRNA. (474 bp)
ggcagtgttagattcccttgtgccgggagacctggtggagttccaaaggtcgtggctcttctcccactgggccgtttatattggtaatgaagaagtggtccattttattgaacgcaattcaggaggtgtcttcagttcctctagtgagcgttctatgacgggggtagttcgaagggattccttttggacagtggcagggaggagtaaggcgttcaaaaacaacagaagggacgccaaatacagctgtgatgtgatagtgacgagggctctgtcaaagctgggagtgagcgagttcaatctcttcttgagaaatagtgaacattttgtagcctggtgtagatatggtgaagagtgcagtgaacaggcacaaaccatctggacaatgtttttggggtctatggctgtaattgtggggggcattgccgcactcactggccttaggcgatag
position 321
XM_013559232.1 - Lingula anatina - NCBI
PREDICTED: Raphanus sativus HVA22-like protein d (LOC108851572), mRNA. (810 bp)
ORIGIN // agcctcaacaatttcgcagagttgtctctctgtttctctcactcttccagattttagtagcttctgaattttattttattttataagagaaaaatgaccaagttctggactttactcactgctcttcatacaggcgctgggcctgtggtgatgttagtatatccactgtacgcatcggtggtagctatggagaccgcaacgaaagtagacgatgaacagtggctatcctactggatcatatactcgttcctgacgctcacggagctgattctacaatctcttcttgagtggattcctatttggtactcggtcaaacttgtgttcgtcgcttggttggttctgcctcagttccatggagctgctttcatctacaacagtttggtgagagaacagttcaagaaacacggcgtcttctctcaccaacagtcaaagcccaccaaacccaagatccttaactccattttcccccaccgggagggacacgaggctcactctcactgacacaagaaaaaaaaaaaggaagaaagcttgactggtattgtaatggagttggtagtggtcccatcttgactaatcttacgttttacttt...
position 274
XM_018625025.2 - Raphanus sativus (radish) - NCBI
PREDICTED: Theobroma cacao uncharacterized LOC108661919 (LOC108661919), mRNA. (507 bp)
cgtcataaggatgacgatgatcaggcagcatgcgtgatgctaaccagtatgactcctgagctccaaaagcagtatgagcacatggatgtccaatccataattcttcatcttagaaaattgttcgataaggaatggcgcattgagagatatgagatctctaaagaactattccgatgcaagatggtagaaatgagttttcttagaccccatgtgccgaagatgattggactcatcgagagacttagacaattgggattagcaatggatcatgggctaagtatagacttaattctacaatctcttcttgacagcttcagttag
position 481
XM_018120908.1 - Theobroma cacao (cacao) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/comp%3acaagaagagattg
lang : en | div : | spe : | query_string : comp:caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.079 | 0.079 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(nt:caatctcttcttg)?to=0&format=json
0.233 | 0.154 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(nt:caatctcttcttg)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.240 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]