2024-05-18 20:49:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009862996 1322 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis ADP-ribosylation factor-like protein 6 (LOC100182512), mRNA. ACCESSION XM_009862996 VERSION XM_009862996.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq; corrected model. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004190397.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_009862996.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-219 EAAA01003465.1 20411-20629 220-383 EAAA01003465.1 20983-21146 384-424 EAAA01003465.1 21574-21614 425-513 EAAA01003465.1 21616-21704 514-1322 EAAA01003465.1 21899-22707 FEATURES Location/Qualifiers source 1..1322 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="Unknown" gene 1..1322 /gene="LOC100182512" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 ESTs, 20 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 192 samples with support for all annotated introns" /db_xref="GeneID:100182512" CDS 35..592 /gene="LOC100182512" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: ADP-ribosylation factor-like protein 6" /protein_id="XP_009861298.1" /db_xref="GeneID:100182512" /translation="
MGIMNKLFGWLKGKKKEANVLCVGLDNSGKTTIINYLKPNDAQQVDIVPTVGFNVEKVTMTNLSFTVFDMSGQGRYRVLWSHYYKETQGVIFVVDSADKLRMAVAKDELDQLLKHQTIMNKRIPILFFANKMDVQNSLSAVKCSQLLGLENIKEKPWHICASNAKTGEGLSDGMHWLSDQLQTVK"
misc_feature 89..574 /gene="LOC100182512" /note="Arf-like 6 (Arl6) GTPase; Region: Arl6; cd04157" /db_xref="CDD:206722" misc_feature 104..127 /gene="LOC100182512" /note="G1 box; other site" /db_xref="CDD:206722" misc_feature order(110..130,179..184,248..250,422..427,431..433, 521..529) /gene="LOC100182512" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206722" misc_feature order(110..115,125..127,137..139,179..202,266..268, 281..283) /gene="LOC100182512" /note="putative GAP interaction site [polypeptide binding]; other site" /db_xref="CDD:206722" misc_feature order(140..154,161..193) /gene="LOC100182512" /note="Switch I region; other site" /db_xref="CDD:206722" misc_feature order(182..196,209..211,239..241,251..253,269..271, 275..283) /gene="LOC100182512" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206722" misc_feature 182..184 /gene="LOC100182512" /note="G2 box; other site" /db_xref="CDD:206722" misc_feature order(185..208,236..238,269..271,278..283) /gene="LOC100182512" /note="putative effector interaction site [active]" /db_xref="CDD:206722" misc_feature order(194..214,221..238) /gene="LOC100182512" /note="interswitch region [active]" /db_xref="CDD:206722" misc_feature 239..292 /gene="LOC100182512" /note="Switch II region; other site" /db_xref="CDD:206722" misc_feature 239..250 /gene="LOC100182512" /note="G3 box; other site" /db_xref="CDD:206722" misc_feature 422..433 /gene="LOC100182512" /note="G4 box; other site" /db_xref="CDD:206722" misc_feature 521..529 /gene="LOC100182512" /note="G5 box; other site" /db_xref="CDD:206722" ORIGIN
tttttaggctttaattaagttaaataactaaaaaatgggtataatgaacaagttatttggctggcttaaaggcaaaaagaaagaggccaatgttttatgtgtaggtttagacaacagtgggaaaactacaatcattaattacctgaaaccaaacgacgcacaacaagtagatattgtacctactgtaggattcaatgtagaaaaagttacaatgaccaatctctcattcactgtgtttgatatgagtgggcaaggacgttacagagttctctggtcacattactacaaggaaacacagggcgttatatttgtagtggacagtgcagataaactgagaatggctgtagctaaagatgaattagaccagcttttgaagcaccaaacaattatgaacaaaagaattcccattttatttttcgctaacaaaatggacgttcagaattctctgtccgcagttaaatgttcgcagttacttggtttggaaaatattaaagaaaaaccatggcatatatgtgctagcaatgctaagacaggagaaggcttaagcgacggaatgcactggttatctgaccaacttcaaactgttaagtgatacgccatgtttggaacttgattgaacttaagtgtttcatatactataggaccagtggcgttgattttataaaaaaaagttgactttataaattatcaaaaagggttaaatgttatgtatgtaagactaagagtacatttgcatttattttaagtgcttttaaaattggaaatttagggtaagcctacataccctgcaacatatttatcgtattcgctaatacaaagccctaagcttggcattttattttattcgagttgaaacatattataatgtttactttactgaagggtatataaacacgtgtttataaaaaattcatatatattattttttataagtttttcagtatgctatgtttattttactaatgggtaccaacttaaaatactattgttttcatagcaaaaattcatatatattttacatttacattaagtctgtttttttttactttttaagaccccgcattgctaatggtgcaataacactgtgaaaaatacattgtggtcattttaaagacattttttaggatgtattaccccctaacatatgttatatataaatataggcttgcctattcataatatctcaattttgtgtcaacccttaactatttcatgcgctatatggtaaaaatgccagtagtatattgttttgtgccatattctgcttttaaatatgttatcgttgtgaaaaaataaatttgaaaggaaaacttacaatttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]