GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2019-02-19 01:13:16, GGRNA : RefSeq release 92 (Jan, 2019)



Matches are highlighted with green background. Overlapping matches are dark colored.

Ciona intestinalis transcription factor ATBF (atbf), mRNA. (3957 bp)
misc_feature order(284..298,302..304,353..355,371..373,410..412, 416..421,428..433,437..445,449..454) /gene="atbf" /gene_synonym="Ci-ATBF" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 290..451 /gene="atbf" /gene_synonym="Ci-ATBF" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(290..292,299..301,419..421,428..433,440..442) /gene="atbf" /gene_synonym="Ci-ATBF" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature order...
Synonym: Ci-ATBF
NM_001048000.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein BarH-like 1 (LOC100180227), mRNA. (1682 bp)
RNAseq alignments, including 26 samples with support for all annotated introns" /db_xref="GeneID:100180227" CDS 126..437 /gene="LOC100180227" /codon_start=1 /product="homeobox protein BarH-like 1" /protein_id="XP_026691108.1" /db_xref="GeneID:100180227" /translation="MGLERKFEQKKYLSTPDRMELAETLGLTQLQVKTWYQNRRMKWKKQSQLNGSIVDSQLKPKGRPRKSPEPEPKLRQNVVEKIVSNVNSSLMQSSDHVINETEN" misc_feature <132..257 /gene="LOC100180227" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN //...
XM_026835307.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein ceh-22-like (LOC104266693), partial mRNA. (619 bp)
similarity to: 6 Proteins" /db_xref="GeneID:104266693" CDS 1..>619 /gene="LOC104266693" /codon_start=1 /product="homeobox protein ceh-22-like" /protein_id="XP_009861841.1" /db_xref="GeneID:104266693" /translation="MHATKSSSFSVRDILQMPGHPTQWYHSNSDYGMPDDKRDYYEQERDKGIKEYDHSDVITGHSDIMTGHNTFQPPPYFHNDSINEHAIESTLTEDQADVTSSQLTSYPASGSSQSRDENISRESLDHVVADDVINDSCFIRHNEKPTSPDSDVIMNKRDEVEKRRKRRVLFSKQQTYELDRRFRHQKYLSAPEREALANTIGVNAHA" misc_feature 496..>606 /gene="LOC104266693" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_009863539.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein MSX-3 (LOC778699), mRNA. (1827 bp)
XM_004226288.4 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor Hox13 (hox13), transcript variant X1, mRNA. (1555 bp)
LOCUS XM_026834904 1555 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor Hox13 (hox13), transcript variant X1, mRNA. ACCESSION XM_026834904 VERSION XM_026834904.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 447..608 /gene="hox13" /gene_synonym="Ci-Hox13; hox12/13" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(447..449,456..458,576..578,585..590,597..599) /gene="hox13" /gene_...
Synonym: Ci-Hox13; hox12/13
XM_026834904.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-A7-like (LOC100182939), mRNA. (1040 bp)
LOCUS XM_026840279 1040 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein Hox-A7-like (LOC100182939), mRNA. ACCESSION XM_026840279 VERSION XM_026840279.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq; includes ab initio. SOURCE Ciona intestinalis...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 825..983 /gene="LOC100182939" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN //...
XM_026840279.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-C12a (LOC778572), mRNA. (2794 bp)
XM_002123146.4 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis homeobox transcription factor Hox13 (hox13), mRNA. (1315 bp)
product="homeobox transcription factor Hox13" /protein_id="NP_001122344.1" /db_xref="GeneID:100169888" /translation="MRNVRTAYVMTVSAYCCAALGLQHGPSHSRKKRQPYSKTQISSLEREYKANNFITRQKRENIARDLKLSDRQVKIWFQNRRVKDKKIKQREIKDNQQHHQTTELQRRDSHTQKQEMYQRHSAMIPIEMKNEHIRIDHIHSHVPGLGSASILM" misc_feature order(179..193,197..199,248..250,266..268,305..307, 311..316,323..328,332..340,344..349) /gene="hox13" /gene_synonym="Ci-Hox13; hox12/13" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 185..346 /gene="hox13" /gene_synonym="Ci-Hox13; hox12/13" /note="Homeobox domain; Region:...
Synonym: Ci-Hox13; hox12/13
NM_001128872.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein MSH-B (LOC778698), mRNA. (1158 bp)
LOCUS XM_002121178 1158 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein MSH-B (LOC778698), mRNA. ACCESSION XM_002121178 VERSION XM_002121178.4 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 573..731 /gene="LOC778698" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_002121178.4 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor Pax6 (pax6), transcript variant X1, mRNA. (1953 bp)
LOCUS XM_026835747 1953 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor Pax6 (pax6), transcript variant X1, mRNA. ACCESSION XM_026835747 VERSION XM_026835747.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...Ci-Pax6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238076" misc_feature <708..1073 /gene="pax6" /gene_synonym="Ci-Pax6" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="CDD:332641" misc_feature order...
Synonym: Ci-Pax6
XM_026835747.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein BarH-like 1b (LOC778552), transcript variant X1, mRNA. (1179 bp)
LOCUS XM_026838897 1179 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein BarH-like 1b (LOC778552), transcript variant X1, mRNA. ACCESSION XM_026838897 VERSION XM_026838897.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...gene="LOC778552" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 524..685 /gene="LOC778552" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(524..526,533..535,653..655,662..667,674..676) /gene="LOC778552" /note="specific...
XM_026838897.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein engrailed-2a-like (LOC101242288), mRNA. (2262 bp)
LOCUS XM_004226074 2262 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein engrailed-2a-like (LOC101242288), mRNA. ACCESSION XM_004226074 VERSION XM_004226074.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1959..2117 /gene="LOC101242288" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN //...
XM_004226074.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-D9a (LOC778556), mRNA. (1640 bp)
LOCUS XM_002123477 1640 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein Hox-D9a (LOC778556), mRNA. ACCESSION XM_002123477 VERSION XM_002123477.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1091..1249 /gene="LOC778556" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_002123477.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis paired superclass homeobox transcription factor (pitx), transcript variant X1, mRNA. (1882 bp)
LOCUS XM_009863002 1882 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis paired superclass homeobox transcription factor (pitx), transcript variant X1, mRNA. ACCESSION XM_009863002 VERSION XM_009863002.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...misc_feature 880..1035 /gene="pitx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(883..885,1003..1005,1012..1017,1024..1026) /gene="pitx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature...
XM_009863002.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein DTH-2 (LOC778697), mRNA. (2091 bp)
LOCUS XM_002127463 2091 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein DTH-2 (LOC778697), mRNA. ACCESSION XM_002127463 VERSION XM_002127463.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona...gene="LOC778697" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1037..1198 /gene="LOC778697" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1037..1039,1046..1048,1166..1168,1175..1180, 1187..1189) /gene="LOC778697" /...
XM_002127463.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor Hox1 (hox1), transcript variant X1, mRNA. (1647 bp)
LOCUS XM_018815614 1647 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor Hox1 (hox1), transcript variant X1, mRNA. ACCESSION XM_018815614 VERSION XM_018815614.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004190417.1) annotated using gene...
Synonym: Ci-Hox1
XM_018815614.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-A2 (LOC778789), mRNA. (1392 bp)
LOCUS XM_009860412 1392 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein Hox-A2 (LOC778789), mRNA. ACCESSION XM_009860412 VERSION XM_009860412.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq; includes ab initio. SOURCE Ciona intestinalis (vase tunicate)...gene="LOC778789" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 457..618 /gene="LOC778789" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(457..459,466..468,586..588,595..600,607..609) /gene="LOC778789" /note="specific...
XM_009860412.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis Dmbx protein (dmbx), mRNA. (1057 bp)
misc_feature 160..339 /gene="dmbx" /gene_synonym="DMBX1" /note="Region: homeobox domain" misc_feature 163..339 /gene="dmbx" /gene_synonym="DMBX1" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(163..177,181..183,232..234,250..252,289..291, 295..300,307..312,316..324,328..333) /gene="dmbx" /gene_synonym="DMBX1" /note="DNA binding site [nucleotide binding]" /...
Synonym: DMBX1
NM_001032796.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis homeobox transcription factor, LAG1-like 4 (LOC100169897), mRNA. (1256 bp)
LOCUS NM_001128878 1256 bp mRNA linear INV 18-APR-2013 DEFINITION Ciona intestinalis homeobox transcription factor, LAG1-like 4 (LOC100169897), mRNA. ACCESSION NM_001128878 VERSION NM_001128878.1 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB210524.1. ##Evidence-Data-START## Transcript exon combination :: AB210524.1...
NM_001128878.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor Pax1/9 (pax1/9), transcript variant X1, mRNA. (1779 bp)
LOCUS XM_018813865 1779 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor Pax1/9 (pax1/9), transcript variant X1, mRNA. ACCESSION XM_018813865 VERSION XM_018813865.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020176.2) annotated using gene...
Synonym: Ci-Pax1/9
XM_018813865.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein not2 (LOC778836), mRNA. (1752 bp)
LOCUS XM_018815634 1752 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein not2 (LOC778836), mRNA. ACCESSION XM_018815634 VERSION XM_018815634.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004190418.1) annotated using gene prediction method: Gnomon,...
XM_018815634.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein OTX1 (LOC778736), mRNA. (1195 bp)
LOCUS XM_002119663 1195 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein OTX1 (LOC778736), mRNA. ACCESSION XM_002119663 VERSION XM_002119663.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020176.2) annotated using gene prediction method: Gnomon, supported...
XM_002119663.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx5 (LOC778665), mRNA. (1484 bp)
LOCUS XM_026837825 1484 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx5 (LOC778665), mRNA. ACCESSION XM_026837825 VERSION XM_026837825.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona...gene="LOC778665" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 715..876 /gene="LOC778665" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(715..717,724..726,844..846,853..858,865..867) /gene="LOC778665" /note="specific...
XM_026837825.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-D3-like (LOC101242509), transcript variant X3, mRNA. (1047 bp)
LOCUS XM_026833867 1047 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein Hox-D3-like (LOC101242509), transcript variant X3, mRNA. ACCESSION XM_026833867 VERSION XM_026833867.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020168.2) annotated using gene...
XM_026833867.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis homeobox transcription factor Pax6 (pax6), mRNA. (1930 bp)
LOCUS NM_001032469 1930 bp mRNA linear INV 29-OCT-2018 DEFINITION Ciona intestinalis homeobox transcription factor Pax6 (pax6), mRNA. ACCESSION NM_001032469 VERSION NM_001032469.1 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 768..926 /gene="pax6" /gene_synonym="Ci-Pax6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1930) AUTHORS Irvine,S.Q., Fonseca,V.C., Zompa,M.A. and...
Synonym: Ci-Pax6
NM_001032469.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx9 (LOC778666), mRNA. (1577 bp)
LOCUS XM_002123997 1577 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx9 (LOC778666), mRNA. ACCESSION XM_002123997 VERSION XM_002123997.4 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 719..877 /gene="LOC778666" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_002123997.4 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein BarH-like 1b (LOC778552), transcript variant X2, mRNA. (1176 bp)
LOCUS XM_018816006 1176 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein BarH-like 1b (LOC778552), transcript variant X2, mRNA. ACCESSION XM_018816006 VERSION XM_018816006.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004190446.2) annotated using gene...
XM_018816006.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein SIX6 (LOC778753), mRNA. (1491 bp)
LOCUS XM_002119507 1491 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein SIX6 (LOC778753), mRNA. ACCESSION XM_002119507 VERSION XM_002119507.4 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020175.2) annotated using gene prediction method: Gnomon, supported...
XM_002119507.4 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein 9 (LOC100175057), transcript variant X2, mRNA. (1570 bp)
LOCUS XM_002131160 1570 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein 9 (LOC100175057), transcript variant X2, mRNA. ACCESSION XM_002131160 VERSION XM_002131160.4 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene prediction...
XM_002131160.4 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), transcript variant X3, mRNA. (2366 bp)
LOCUS XM_009861448 2366 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), transcript variant X3, mRNA. ACCESSION XM_009861448 VERSION XM_009861448.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 729..890 /gene="lhx3" /gene_synonym="Ci-Lhx3a; Lhx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(729..731,738..740,858..860,867..872,879..881) /gene="lhx3" /gene_synonym...
Synonym: Ci-Lhx3a; Lhx4
XM_009861448.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein 10 (LOC778737), mRNA. (1908 bp)
LOCUS XM_0188 1908 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein 10 (LOC778737), mRNA. ACCESSION XM_0188 VERSION XM_0188.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene prediction method: Gnomon, supported by EST evidence...
XM_018811111.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor Pax1/9 (pax1/9), transcript variant X2, mRNA. (1754 bp)
LOCUS XM_009861895 1754 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor Pax1/9 (pax1/9), transcript variant X2, mRNA. ACCESSION XM_009861895 VERSION XM_009861895.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020176.2) annotated using gene...
Synonym: Ci-Pax1/9
XM_009861895.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox-containing protein 1 (LOC778606), transcript variant X3, mRNA. (3015 bp)
LOCUS XM_018811998 3015 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox-containing protein 1 (LOC778606), transcript variant X3, mRNA. ACCESSION XM_018811998 VERSION XM_018811998.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene...
XM_018811998.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor hox2 (hox2), transcript variant X2, mRNA. (2358 bp)
LOCUS XM_026833761 2358 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor hox2 (hox2), transcript variant X2, mRNA. ACCESSION XM_026833761 VERSION XM_026833761.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...hox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1079..1237 /gene="hox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN //...
XM_026833761.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox transcription factor hox2 (hox2), transcript variant X1, mRNA. (2440 bp)
LOCUS XM_026833760 2440 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox transcription factor hox2 (hox2), transcript variant X1, mRNA. ACCESSION XM_026833760 VERSION XM_026833760.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...hox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1161..1319 /gene="hox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN //...
XM_026833760.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis paired superclass homeobox transcription factor (pitx), transcript variant X2, mRNA. (1891 bp)
LOCUS XM_018815448 1891 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis paired superclass homeobox transcription factor (pitx), transcript variant X2, mRNA. ACCESSION XM_018815448 VERSION XM_018815448.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004190397.2) annotated...
XM_018815448.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox-containing protein 1 (LOC778606), transcript variant X1, mRNA. (3051 bp)
LOCUS XM_018811990 3051 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox-containing protein 1 (LOC778606), transcript variant X1, mRNA. ACCESSION XM_018811990 VERSION XM_018811990.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene...
XM_018811990.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), mRNA. (2637 bp)
gene="lhx3" /gene_synonym="Ci-Lhx3a; Lhx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(981..983,990..992,1110..1112,1119..1124,1131..1133) /gene="lhx3" /gene_synonym="Ci-Lhx3a; Lhx4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 2637) AUTHORS Kobayashi,M., Takatori,N., Nakajima,Y., Kumano,G., Nishida,H. and Saiga,H. TITLE Spatial and temporal expression of two transcriptional isoforms of Lhx3, a LIM class homeobox gene, during embryogenesis of two phylogenetically...
Synonym: Ci-Lhx3a; Lhx4
NM_001078287.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), transcript variant X1, mRNA. (2708 bp)
LOCUS XM_026839731 2708 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), transcript variant X1, mRNA. ACCESSION XM_026839731 VERSION XM_026839731.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1069..1230 /gene="lhx3" /gene_synonym="Ci-Lhx3a; Lhx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(1069..1071,1078..1080,1198..1200,1207..1212, 1219..1221) /gene="lhx3" /...
Synonym: Ci-Lhx3a; Lhx4
XM_026839731.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), transcript variant X2, mRNA. (3581 bp)
LOCUS XM_026839732 3581 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx3a type 1 (lhx3), transcript variant X2, mRNA. ACCESSION XM_026839732 VERSION XM_026839732.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1944..2105 /gene="lhx3" /gene_synonym="Ci-Lhx3a; Lhx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(1944..1946,1953..1955,2073..2075,2082..2087, 2094..2096) /gene="lhx3" /...
Synonym: Ci-Lhx3a; Lhx4
XM_026839732.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein unc-4 homolog (LOC778790), partial mRNA. (1488 bp)
LOCUS XM_009861931 1488 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein unc-4 homolog (LOC778790), partial mRNA. ACCESSION XM_009861931 VERSION XM_009861931.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq; corrected model. SOURCE Ciona intestinalis...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1147..1305 /gene="LOC778790" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 AUTHORS Imai,K.S., Hino,K., Yagi,K., Satoh,N. and Satou,Y. TITLE Gene...
XM_009861931.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-D3-like (LOC101242509), transcript variant X1, mRNA. (1174 bp)
LOCUS XM_004225838 1174 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein Hox-D3-like (LOC101242509), transcript variant X1, mRNA. ACCESSION XM_004225838 VERSION XM_004225838.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020168.2) annotated using gene...
XM_004225838.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis homeobox transcription factor Hox1 (hox1), mRNA. (1506 bp)
LOCUS NM_001128861 1506 bp mRNA linear INV 29-OCT-2018 DEFINITION Ciona intestinalis homeobox transcription factor Hox1 (hox1), mRNA. ACCESSION NM_001128861 VERSION NM_001128861.1 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata;...Ci-Hox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 811..969 /gene="hox1" /gene_synonym="Ci-Hox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(817..819,937..939,946..951,958..960) /gene="hox1" /gene_synonym="Ci-...
Synonym: Ci-Hox1
NM_001128861.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis homeobox transcription factor Pax1/9 (pax1/9), mRNA. (1698 bp)
LOCUS NM_001032422 1698 bp mRNA linear INV 29-OCT-2018 DEFINITION Ciona intestinalis homeobox transcription factor Pax1/9 (pax1/9), mRNA. ACCESSION NM_001032422 VERSION NM_001032422.1 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB020762.1. ##Evidence-Data-START## Transcript exon combination :: AB020762.1, AB210627.1...
Synonym: Ci-Pax1/9
NM_001032422.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis diencephalon/mesencephalon homeobox protein 1-like (LOC100178876), mRNA. (973 bp)
LOCUS XM_002119104 973 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis diencephalon/mesencephalon homeobox protein 1-like (LOC100178876), mRNA. ACCESSION XM_002119104 VERSION XM_002119104.3 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene...
XM_002119104.3 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis paired superclass homeobox transcription factor (pitx), mRNA. (1788 bp)
LOCUS NM_001032517 1788 bp mRNA linear INV 07-DEC-2018 DEFINITION Ciona intestinalis paired superclass homeobox transcription factor (pitx), mRNA. ACCESSION NM_001032517 XM_004227039 XM_004227040 XM_009863003 VERSION NM_001032517.2 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EAAA01003470.1. On Dec 7, 2018 this sequence...
Synonym: Ci-Pitx; PITX1
NM_001032517.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein 9 (LOC100175057), transcript variant X1, mRNA. (1572 bp)
LOCUS XM_018815079 1572 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein 9 (LOC100175057), transcript variant X1, mRNA. ACCESSION XM_018815079 VERSION XM_018815079.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene prediction...
XM_018815079.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox protein Hox-D3-like (LOC101242509), transcript variant X2, mRNA. (1168 bp)
LOCUS XM_026833866 1168 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox protein Hox-D3-like (LOC101242509), transcript variant X2, mRNA. ACCESSION XM_026833866 VERSION XM_026833866.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020168.2) annotated using gene...
XM_026833866.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
PREDICTED: Ciona intestinalis homeobox-containing protein 1 (LOC778606), transcript variant X2, mRNA. (3019 bp)
LOCUS XM_002121035 3019 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis homeobox-containing protein 1 (LOC778606), transcript variant X2, mRNA. ACCESSION XM_002121035 VERSION XM_002121035.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene...
XM_002121035.2 - Ciona intestinalis (vase tunicate) - NCBI - UCSC
Ciona intestinalis homeobox transcription factor TTF1 (titf1), mRNA. (2297 bp)
LOCUS NM_001032495 2297 bp mRNA linear INV 29-OCT-2018 DEFINITION Ciona intestinalis homeobox transcription factor TTF1 (titf1), mRNA. ACCESSION NM_001032495 VERSION NM_001032495.1 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AJ009607.1. ##Evidence-Data-START## Transcript exon combination :: AJ009607.1, AB210735.1...
Synonym: Ci-TTF1; TTF1
NM_001032495.1 - Ciona intestinalis (vase tunicate) - NCBI - UCSC

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : ci | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.106 | 0.106 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Ciona intestinalis (vase tunicate)?to=0&format=json
0.218 | 0.112 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Ciona intestinalis (vase tunicate)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.223 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]