LOCUS       XM_026837825            1484 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis LIM/homeobox protein Lhx5
            (LOC778665), mRNA.
ACCESSION   XM_026837825
VERSION     XM_026837825.1
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004190346.2) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1484
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="Unknown"
     gene            1..1484
                     /gene="LOC778665"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 9 ESTs, 4 Proteins, and
                     78% coverage of the annotated genomic feature by RNAseq
                     alignments, including 8 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:778665"
     CDS             28..1227
                     /gene="LOC778665"
                     /codon_start=1
                     /product="LIM/homeobox protein Lhx5"
                     /protein_id="XP_026693626.1"
                     /db_xref="GeneID:778665"
                     /translation="

MEGPLCSRCNHVISNKFVFQVDGKFWHGDCVVCSDCECPLSNRCYVRNEELFCSDDFCRRFGKKCGGCGGALYPNDLVHKVGQINSVFHVRCFVCYVCNNNLEPGKPFQANERGLLCKDDYVAMTSSGDSEEEVWGESNAHVISDVTGVASEVKMTKQLIDEGEAKPGVWENEGGEVSKLAGFENRHPGQDDEDSLMSQQTKDSSASTAIDTSPPQQGCIAIAATKRRGPRTTIKAKQLETLKNAFLSTPKPTRHIREKLAQDTGLSMRVIQVWFQNRRSKERRIKQLNTMVARRQYFDHVPNIDVTNEQRFYADPHYYPQQQPNYYPTAANFNDSRISPTESETWIHRIDDNHHVYDDIMYDDVTQSQNGGFPGFAPRTAEGAICEQSGKSIVYWNAA"

     misc_feature    37..198
                     /gene="LOC778665"
                     /note="LIM is a small protein-protein interaction domain,
                     containing two zinc fingers; Region: LIM; cl02475"
                     /db_xref="CDD:413332"
     misc_feature    order(43..45,52..54,106..108,115..117,124..126,133..135,
                     184..186,193..195)
                     /gene="LOC778665"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:259829"
     misc_feature    250..390
                     /gene="LOC778665"
                     /note="LIM is a small protein-protein interaction domain,
                     containing two zinc fingers; Region: LIM; cl02475"
                     /db_xref="CDD:413332"
     misc_feature    order(709..723,727..729,778..780,796..798,835..837,
                     841..846,853..858,862..870,874..879)
                     /gene="LOC778665"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    715..876
                     /gene="LOC778665"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(715..717,724..726,844..846,853..858,865..867)
                     /gene="LOC778665"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      

gtcttagttggaagtttattcaaaacaatggaaggacctttatgtagcagatgtaaccacgtgatcagcaacaagtttgtatttcaggtggacgggaaattctggcacggcgattgcgtcgtttgttccgattgtgaatgcccattgtctaaccgttgttacgtcagaaatgaagaattattttgcagcgacgacttttgtcgtcgcttcggtaagaaatgtggggggtgcgggggtgcattgtaccccaacgacctcgtgcacaaagtcgggcagataaactccgtgtttcacgttcgatgtttcgtatgctatgtttgcaacaataaccttgaacctgggaagccttttcaagctaatgaaagagggctgctctgtaaggatgattacgtagcgatgacgtcatcaggagattccgaagaagaagtttggggagaaagtaatgcacacgtcatcagtgacgtcacaggggtggcatcggaagtgaaaatgacgaaacaattgatcgacgagggtgaggctaaacctggggtgtgggaaaatgaaggaggcgaagtatcaaagttggcggggtttgagaaccgacatcctggccaagatgatgaagattccttgatgtcgcaacaaacgaaagattcgagcgcgtcgaccgcgattgacacgtcaccaccccaacaaggatgcatcgcgattgcagcgacgaagcgtcgtggaccgcggacgacgataaaagcaaaacaattggaaacgctgaaaaatgctttccttagcacccctaaacccacacgtcatatccgggagaagttggcgcaagatacaggcctctcgatgcgggtgattcaggtttggttccagaatcgtcgaagcaaagaaagaagaattaaacaattaaacacgatggtagcgcgacgtcagtactttgatcacgtgcccaatattgacgtcacaaatgaacaaagattttatgcagatcctcactactacccacaacaacaacccaactattacccaaccgccgccaacttcaacgacagtagaatctcaccaacagaaagtgaaacctggattcatagaatagatgacaaccatcatgtgtatgatgacatcatgtatgatgacgtcactcaatctcagaacggggggttccctgggttcgcgccccgaaccgcggaaggcgcgatttgcgaacaaagcggaaaatctattgtttactggaatgcagcgtgatcagtgacgtcataatgctcctattgttttggttcttgtaaattccatttttatcgtacagttccaattgtgacgtcataaatatagattatgtataaagatgattgtgacgtaagaagcatcgattgttatcaacaatgggagttgtgaaactttgatattcgggaaaatcttcaattcatcaaaatcatagagcagaaagttggcgccgagtttcacgattttaataaaaatttacagcgtgcggcttcctcgga

//