GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-03 05:40:16, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_002132110             772 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis epithelial membrane protein 2
            (LOC100177389), mRNA.
ACCESSION   XM_002132110
VERSION     XM_002132110.3
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020166.2) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_002132110.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..772
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="1"
     gene            1..772
                     /gene="LOC100177389"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 92 ESTs, and 100% coverage
                     of the annotated genomic feature by RNAseq alignments,
                     including 204 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:100177389"
     CDS             65..562
                     /gene="LOC100177389"
                     /codon_start=1
                     /product="epithelial membrane protein 2"
                     /protein_id="XP_002132146.1"
                     /db_xref="GeneID:100177389"
                     /translation="
MVCTKKIQIASAAIALIGFIFLLVAICTNYWITSDVESNSGLWRACSAGNCENLKIGSSRKYENYEMVRGFGVLAVCVCFLGIVLSLLSCVIRRVKIGPSVVATLYLMAAFFGLTSLALFTSIVNTKNSDVNRAWGYSFILGWFAFPLTLFPGVVMTYVELKMTN"
     misc_feature    107..526
                     /gene="LOC100177389"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
gtatttcagatatgaccactttttcatcacagatttagaataggcgttaacgtgtgacatcaaaatggtctgcactaaaaaaatccaaatagcttcggctgcgattgctcttattggtttcatatttctgctcgtcgcaatatgcaccaattattggatcacaagtgatgttgaatccaactccggtctttggcgagcttgcagcgctgggaattgtgaaaatttgaaaattggatccagcagaaaatatgagaactatgaaatggtccgtggattcggtgttctggccgtgtgtgtttgtttccttggcatcgttctgtctcttctcagttgtgtcatccgtcgagttaaaattggaccctcagtagtggcaacactctaccttatggctgcgtttttcggtcttacgagtcttgctctattcacaagcattgtgaacacaaagaattcggatgtgaacagagcatggggatattccttcattctgggttggttcgctttcccacttactcttttccctggagttgtaatgacatacgtcgagttgaaaatgaccaactgagacttcaagttaacaacctgcggattttgtccataacttttcgccttttatgtaattgattaatcattttattcacttttaatgcgacggcattttgccagtttttttttatgtacatagcgtgtagcagaggccttcactacgtatcatgtaactcattttttacgtgtttttactgacttttaataaatatatgctaatataaagtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]