LOCUS       XM_002128098            1002 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis prefoldin subunit 6-like
            (LOC100179681), mRNA.
ACCESSION   XM_002128098
VERSION     XM_002128098.5
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020172.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_002128098.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1002
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="7"
     gene            1..1002
                     /gene="LOC100179681"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 57 ESTs, 5 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 225 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100179681"
     CDS             33..404
                     /gene="LOC100179681"
                     /codon_start=1
                     /product="prefoldin subunit 6-like"
                     /protein_id="XP_002128134.1"
                     /db_xref="GeneID:100179681"
                     /translation="

MGAVDAQVRLELQKEFDEIQKVQKEIQKSAELQKKLDSQLNQNTVVKDELEFLEPESNVYKLTGPVLVKQDLGEAKGTVSKRIEYISAEIKRQETLVADLEKQLNKHKESVSKIQAKATAVAH"

     misc_feature    66..380
                     /gene="LOC100179681"
                     /note="Prefoldin beta; Prefoldin is a hexameric molecular
                     chaperone complex, composed of two evolutionarily related
                     subunits (alpha and beta), which are found in both
                     eukaryotes and archaea. Prefoldin binds and stabilizes
                     newly synthesized polypeptides...; Region: Prefoldin_beta;
                     cd00632"
                     /db_xref="CDD:238345"
     misc_feature    order(69..71,210..212,219..221,225..227,231..233,237..239,
                     252..254)
                     /gene="LOC100179681"
                     /note="Prefoldin subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238345"
ORIGIN      

attttaggagtaaattagggccttatataaacatgggtgctgtggatgctcaagtaaggctggaattgcaaaaagaatttgatgaaattcaaaaagtccagaaggaaattcaaaaatcagcagaactgcagaaaaagcttgattctcaattaaaccagaatactgttgtgaaagatgaattggaattcttggagccggaatcgaatgtctacaagctgactggtcctgttcttgtcaagcaagatttaggtgaagctaaaggcactgtgtcgaaacgtattgaatatataagcgctgaaataaagcgtcaggaaactttagttgcagaccttgaaaagcagttaaacaaacataaagaaagtgtttcaaaaattcaagcaaaagcaactgcagttgctcattgaataatgtgttatattgtttcttttgtgtcaacttagaaacttgtgtttatgtattgcatgcacaatctgggtatatgtagatgctgatataaaagtgatcagtttgaaagttttacaagttggaagcttaagagcattgtaatattacttttgtaaatttaatgtatttttgtattagtttattcggatcttcagttacatatatttattttaaaagctagttctttaaatctgtttaactcgctaaaaaaatcaaatttcaagtttattgtttttaagtacattaaccatacatgcaatatgctatgttcagttctgtagtatataccattagggaagatgagacacctttagcacataatattcaaatatcctgatcgtgttttaaacaattaacaatggtctgtgggagcgttggaaaaccgttttacaaatctttgtttactaccaaatgggacgagaaaataaaataaaaaggtgtcccatcttctcccaccgtacctcatacaatttaaactaatttaagtattaacgaaattacagacaccatgattatgtggtgttgtcgtgtataatagagaaacagaattctgtgtaa

//