2024-05-05 01:12:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_067909 630 bp mRNA linear INV 22-NOV-2023 DEFINITION Caenorhabditis elegans Uncharacterized protein (W08E12.8), partial mRNA. ACCESSION NM_067909 VERSION NM_067909.6 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 630) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 630) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-NOV-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 630) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (29-OCT-2023) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 630) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003282). On Sep 4, 2019 this sequence version replaced NM_067909.5. COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..630 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="IV" gene <1..630 /gene="W08E12.8" /locus_tag="CELE_W08E12.8" /db_xref="GeneID:189295" /db_xref="WormBase:WBGene00021089" CDS 1..456 /gene="W08E12.8" /locus_tag="CELE_W08E12.8" /standard_name="W08E12.8a" /note="Partially confirmed by transcript evidence" /codon_start=1 /product="Uncharacterized protein" /protein_id="NP_500310.1" /db_xref="EnsemblGenomes-Gn:WBGene00021089" /db_xref="EnsemblGenomes-Tr:W08E12.8a" /db_xref="GeneID:189295" /db_xref="UniProtKB/TrEMBL:H2L0M8" /db_xref="WormBase:WBGene00021089" /translation="
MSGFRKDELIPVIIDIHGEKRKMFEDIADTVLRRVLDEEENECPPIESRGSSTSSFSTTPSSSASPLSINQLLSSSFSQPPAPQLPVPLAFNPFQLALYQSLVANNTLAFPVFGGPPSIFPLLVPPPQPQPTVESIELLKILQNMLAKQKK"
ORIGIN
atgagtggattccgaaaggacgaactcatccccgttatcattgacatccatggtgagaagcgtaagatgtttgaagatatcgccgacacggtgttgagaagagttctcgatgaagaagaaaatgagtgtccaccgattgagtcacgtggttccagcacatcatcattttcgacaacgccatcttcgtctgcctcgccgctttccatcaaccaacttctcagttcttcgttctctcaaccgccggcaccccaactgcctgtgccgctggcgttcaacccgttccagctagctctctatcagtctctagttgcgaacaacactctcgcatttcccgtttttggcggtcccccgtcaatatttccgttgcttgttccgccgccgcagccccagccgactgttgagtcgatcgaattgctgaaaattctccaaaatatgttggcaaaacaaaagaagtgattgattcatttcgattttctgtcattctttttcggtgacaaacaattttcaatttttcacaattttcaacgcagttttgtcatttttccatcttctgtcgccttatctcccacctagatgtcatgatgttgttcgaaataaaaattaaataaatatttttgtttcgaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]