2024-05-04 23:57:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001136403 741 bp mRNA linear INV 22-NOV-2023 DEFINITION Caenorhabditis elegans F-box domain-containing protein (Y57G11C.499), partial mRNA. ACCESSION NM_001136403 VERSION NM_001136403.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 741) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 741) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-NOV-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 741) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (29-OCT-2023) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 741) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003282). On Feb 2, 2021 this sequence version replaced NM_001136403.2. COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..741 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="IV" gene <1..>741 /gene="Y57G11C.499" /locus_tag="CELE_Y57G11C.499" /db_xref="GeneID:7040135" /db_xref="WormBase:WBGene00077762" CDS 1..741 /gene="Y57G11C.499" /locus_tag="CELE_Y57G11C.499" /standard_name="Y57G11C.499" /note="Partially confirmed by transcript evidence" /codon_start=1 /product="F-box domain-containing protein" /protein_id="NP_001129875.1" /db_xref="EnsemblGenomes-Gn:WBGene00077762" /db_xref="EnsemblGenomes-Tr:Y57G11C.499" /db_xref="GeneID:7040135" /db_xref="InterPro:IPR001810" /db_xref="InterPro:IPR002900" /db_xref="InterPro:IPR040161" /db_xref="UniProtKB/TrEMBL:B3GWE2" /db_xref="WormBase:WBGene00077762" /translation="
MEEKLKDELNSIKIFNGLSLSRMPTVVVHGVVDNLLEQREPIDRCFLSKVCRQMRDVIYSKDLGFKKVGVHFNMYYLSLCLDNVSFTYKNDESGCNAKCDGRQDELIKKDKLNSFLDDFAIVMKNRKLRLDEFEISGNTFISSERIETLETGVVEWMKKNSIMEKQFKTKKVRLAEVKSDYVIDILSLFKPGVLEKIEINWKKWPASYFDDIDALFELDQWKQANVNWLASSTISNFSFKININFK"
misc_feature 58..204 /gene="Y57G11C.499" /locus_tag="CELE_Y57G11C.499" /note="F-box domain superfamily; Region: F-box_SF; cl45894" /db_xref="CDD:459239" misc_feature order(67..72,76..84,91..96,103..105,148..156,160..162, 169..171) /gene="Y57G11C.499" /locus_tag="CELE_Y57G11C.499" /note="F-box motif; other site" /db_xref="CDD:438852" misc_feature order(67..69,79..81,88..93,100..105,127..129,133..138, 148..156,160..162) /gene="Y57G11C.499" /locus_tag="CELE_Y57G11C.499" /note="Skp1 binding site [polypeptide binding]; other site" /db_xref="CDD:438852" misc_feature 457..>672 /gene="Y57G11C.499" /locus_tag="CELE_Y57G11C.499" /note="FTH domain; Region: FTH; pfam01827" /db_xref="CDD:396410" ORIGIN
atggaggagaaattgaaggacgagttgaattcgatcaaaatcttcaatggtttatcactcagccgcatgccaacggtagtggttcacggagttgtggacaatctcttagagcaaagggagccaattgatagatgctttctctccaaagtgtgccgtcaaatgcgagatgtgatctatagcaaagatcttggattcaagaaagtgggcgtgcacttcaatatgtattatttgtcactgtgcctggataatgtctcattcacctataagaatgacgagtccggttgtaatgcgaaatgcgacggtcgccaggatgaattgatcaaaaaagacaaattgaattcgtttttggatgatttcgccatagtgatgaagaaccgaaaacttcgattggatgaattcgaaatttctggaaatacgttcatcagttcggaacgtatcgaaacattagaaaccggagtcgtagagtggatgaagaagaattcgatcatggaaaagcaatttaaaaccaaaaaagtccgtctcgcagaagtgaagtctgattatgtaatcgatattctgtctctcttcaaacctggagttctcgaaaaaattgagatcaactggaaaaagtggccagcctcttatttcgatgatatcgatgctttgtttgaattggaccaatggaaacaggcaaatgttaattggctggcttcgtctactatctccaatttttcatttaaaatcaatattaattttaaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]