GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-07-19 07:03:07, GGRNA : RefSeq release 88 (May, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Caenorhabditis remanei CRE-TAG-80 protein (Cre-tag-80) mRNA, complete cds. (21927 bp)
gaaacgtataatgaagtgccctgttgttcaaccgaagacgaagaaaccagaaagatacatgaaaccgccaagattctcgtgcaagaaactatggaacaactgatttatgacagtccaacagaatttgaaaaacgagtaaacacgccagaacatcatgaagcagacagatccagtgcaacatcaggagctgactttgagaaatccttggatcaagaagtcgcttatgatcgatcttcacctttcttggaacctgtcgaagagccgattttcgaaaagaaagaaccggaactgactcaagaagagattgatcacatcgcttggattcaaagtctagctgagcggtcatcattcgaacaagcagcacctccgacacatccaccagttcctcaaagaatggcaacagttgaagaaccaattgctacgaccgatcttcatgaagaggacagatccagtgcaacatcgggagctcactttgagaaatcattcgaccaagaagtcgcatacgaacgatcttcacctttgttggaatctgtcgaagagccgattttcgaaaagaaagaacctgaactgactcaagaagagattgatcacatcgcttgg...
position 1867
XM_003107901.1 - Caenorhabditis remanei - NCBI
Caenorhabditis elegans CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife (cla-1), partial mRNA. (25584 bp)
tccacggaaaatgaaattaccaatacgagtaatcaaacagcaaacatagtaattgatccaggaagtattgattcagaagaaataaacaaattagccgcaaaattagttgaagaatcaattctcaaagcatcacaggaagcagcatcagataaccacgagaaagaaagatcaagtgcaacatcaaaagctgattatgaaagatcatttgatcaagacgtcacttatgaaagatcttcaccgttgcttgaaccaagtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcacattgcaaggatccagagtcttgcagaacaatcatcattcgaacaagcttcaacgattcctgatcgaccacctcttccagcccggcttccgactgtagacgagccgattgtcatctcagaacaacacgaagaagacagatcaagtgcaacatcgggagctgactatgaaagatccttcgatcaagaagtcacgtatgaaagatcttcaccgttgcttgaaccatgtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcatattgca...
position 1741
NM_001307220.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife (cla-1), partial mRNA. (26769 bp)
tccacggaaaatgaaattaccaatacgagtaatcaaacagcaaacatagtaattgatccaggaagtattgattcagaagaaataaacaaattagccgcaaaattagttgaagaatcaattctcaaagcatcacaggaagcagcatcagataaccacgagaaagaaagatcaagtgcaacatcaaaagctgattatgaaagatcatttgatcaagacgtcacttatgaaagatcttcaccgttgcttgaaccaagtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcacattgcaaggatccagagtcttgcagaacaatcatcattcgaacaagcttcaacgattcctgatcgaccacctcttccagcccggcttccgactgtagacgagccgattgtcatctcagaacaacacgaagaagacagatcaagtgcaacatcgggagctgactatgaaagatccttcgatcaagaagtcacgtatgaaagatcttcaccgttgcttgaaccatgtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcatattgca...
position 1741
NM_001307219.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Unclassified non-coding RNA ZK1193.9 (ZK1193.9), ncRNA. (133 bp)
AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA gaaggcgaccacgtcgtcgccaagaagagattgaagacgacgaatggagcgaaagtagtaaggaggggttgagggggggggaggtcgggatcgagatggcataatgtaggaaccggatggaagagtctaaaag
position 21
NR_070329.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2), partial mRNA. (198 bp)
G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M. TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute, Beutenbergstr. 11, Jena 07745, Germany atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
position 102
XM_020573799.1 - Heterostelium album PN500 - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC110938512 (LOC110938512), ncRNA. (221 bp)
ncRNA 1..221 /ncRNA_class="lncRNA" /gene="LOC110938512" /product="uncharacterized LOC110938512" /db_xref="GeneID:110938512" ORIGIN // ctcaagtacggcgtgcaacaagtgcctacccacgtcgtcaaagaactcatcatgcacgaggtggtgcttgggggtggccaggatgcatctgctgttaccacaaccatcatcgtgcggggaagtttgaagccaaattttatgacaaggttctgcaagaagagattggaggcgttaaaggacatttcgggccaattaatgctttggcattcaacccggatgga
position 153
XR_002591448.1 - Helianthus annuus (common sunflower) - NCBI
Saccharomyces eubayanus RPL36B-like protein (DI49_5219), partial mRNA. (246 bp)
of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atgactccagctccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcatcagagccaaggctaaggtcgaggaaatgaacaacatcatcgctgcttctcgtcgtcattaa
position 162
XM_018368212.1 - Saccharomyces eubayanus - NCBI
PREDICTED: Terrapene mexicana triunguis disheveled-associated activator of morphogenesis 2-like (LOC112123654), partial mRNA. (289 bp)
FH3 Domain; Region: Drf_FH3; pfam06367" /db_xref="CDD:310747" ORIGIN // gacaatttggaattccgattgcacctgcgatatgagtttctgatgctgggaattcaacctgttattgacaagctaagaggacatgaaaatgcaacattagacaggcacttagatttctttgagatggtgagaaacgaggacgatctggaacttgccaagcggtttgatgtgattcacattgatacaaaaagcgcctctcagatgttcgagatgatcaagaagagattgaagcacacggacgcttatccctatttgctatcagtccttcagcattgcttgcagatgcctt
position 216
XM_024222245.1 - Terrapene mexicana triunguis (Three-toed box turtle) - NCBI
Exophiala aquamarina CBS 119918 hypothetical protein partial mRNA. (288 bp)
Cambridge, MA 02142, USA atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
position 262
XM_013407183.1 - Exophiala aquamarina CBS 119918 - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (297 bp)
Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc
position 64
XM_012897535.1 - Acytostelium subglobosum LB1 - NCBI
Komagataella phaffii GS115 60S ribosomal protein L36 (PAS_FragB_0036), partial mRNA. (306 bp)
/ Gent University, Technologiepark 927, Ghent, 9052, BELGIUM atgagaaatattgtactaacaaattcaggtattgcagtaggtgctaacaagggacacaaggtcaccccaaaggccgttgctccacaaaagagagtcgctatcagccaaagaactgactttgttagaaagttggtccgtgaggtcactggtctgtctccatacgaaagaagaatcattgagttgatcagaaactctggtgagaagagagccagaaagttcgccaagaagagattgggtactcacaccagagctaaggctaagttggaagagatgcaaaacgttatccaggaagcaaagcgtcattaa
position 222
XM_002490801.1 - Komagataella phaffii GS115 - NCBI
Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36 partial mRNA. (288 bp)
US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa
position 204
XM_001383429.1 - Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054) - NCBI
Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 ribosomal protein L36e (METBIDRAFT_76691), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggcccaaaccggtattgctgtcggtttgaacaagggtcacaaaaccacccaaaaggaagttgttccaagactttcccgcaagaagggagtcttgtccaagagagctgctttcgtcagaagcattgtctctgaggtctccggcttggccccatacgagagaagattgatcgagttgatcagaaacgccagcgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaggagatgaacaagatcattgctgagtctaagagacactaa
position 216
XM_018858572.1 - Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 - NCBI
Caenorhabditis elegans Uncharacterized protein (F29B9.11), partial mRNA. (267 bp)
Genome Institute at Washington University, St. Louis, MO 63110, USA atgctgaaccgtgctgtgctctccttggctagaagccaacatgtcatccgtcgctcgcttcacaagggagttgactcgaccccaccactccgtttcacctctgtcagcgagaaggttgccctttacggactcatctgcgtcgctttcatggcatacccaacttccgtcctcttcagacttgatagtcttcgcccaagaccggataatgctctctccccagaagtccaagaagagattgacgcccgtgttgccgcccgcagacagtag
position 226
NM_068208.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Lachancea lanzarotensis LALA0S05e07514g1_1 (LALA0_S05e07514g), partial mRNA. (303 bp)
UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850, France atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcaacgccatgaccccaaccccaaagatctcctacagaaagggtgcttcttccaacagaaccaagttcgtcagatctttggtcaaggaagttgccggtttggccccatacgaaagaagattgatcgatttgatcagaaacgctggtgaaaagagagccagaaaggtggccaagaagagattgggtaccttcggcagagccaaggccaaggtcgaggagatgaacgacatcatcaccgcttctcgtcgtcattaa
position 219
XM_022772423.1 - Lachancea lanzarotensis - NCBI
Saccharomyces eubayanus RPL36A-like protein (DI49_4277), partial mRNA. (303 bp)
Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
position 219
XM_018367307.1 - Saccharomyces eubayanus - NCBI
Kazachstania naganishii CBS 8797 hypothetical protein (KNAG0D00710), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggccgtcaagactggtattgctgttggtttgaacaagggtaagcaggtcaatgctatgaccccagccccaaagatgtcctacaagaagggtgccatctctaacagaacccagttcgtccgctcgctggtgaaggagatcgctggtctgtccccatacgaaagaagactgatcgacttgatcagaaactctggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaagagagccaaggccaaggttgaggagatgaacaacgtcatcgctgcctctcgtcgtcattga
position 219
XM_022607478.1 - Kazachstania naganishii CBS 8797 - NCBI
[Candida] glabrata 60S ribosomal protein L36 (CAGL0K10906g), partial mRNA. (303 bp)
Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr E-mail:david@labri.fr atggccgttaagactggtattgctgttggtttgaacaagggtactaaggtcacccaaatgaccccagccccaaagatctcttacaagaagggtgctgcttctaacagaaccaagttcgttcgttctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagctaaggctaaggttgaagaaatgaactccatcattgctgcttctcgtcgtcactaa
position 219
XM_002999537.1 - [Candida] glabrata (Candida glabrata) - NCBI
Eremothecium gossypii ATCC 10895 60S ribosomal protein L36 (AGOS_AFL163C), partial mRNA. (303 bp)
Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaccccaatgacccctgctccaaaggtctcttacagaaagggtgcctcctccaagagaaccaccttcgtcagatctatcgtcagagaggttgccggcatggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggcacctttggcagagctaaggctaaggttgaggaaatgaacgagatcattgctgcttctagacgtcactag
position 219
NM_210741.1 - Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895) - NCBI
Tetrapisispora blattae CBS 6284 hypothetical protein (TBLA0A02360), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggctgtcaaaactggtattgctgttggtttgaacaaaggtaagcaggtcgtctctatgaccccagctgccaagatctcatacaagaagggccaatcttctcaaagaaccaagttcgtcagatctttggtcagagaaatcgctggtttagctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggttgaagaaatgaacaacatcattgctgcctctcgtcgtcattag
position 219
XM_004177506.1 - Tetrapisispora blattae CBS 6284 - NCBI
Lachancea thermotolerans CBS 6340 60S ribosomal protein L36 partial mRNA. (303 bp)
FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr) atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcacccagatgaccccagccccaaagatctcgtacagaaagggtgcttcctctaacagaaccaagttcgtcagatctttggtcaaggaggtcgccggtttggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggtactttcggcagagccaaggctaaggtcgaggagatgaacgacatcatcaccgcctctcgtcgtcactaa
position 219
XM_002555947.1 - Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS - NCBI
Eremothecium cymbalariae DBVPG#7215 Hypothetical protein partial mRNA. (303 bp)
Laboratory, Gamle Carlsberg Vej 10, Copenhagen V DK-1899, Denmark atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaactcgatgaccccagccccaaagatctcttacagaaagggtgcttcttccaagagaacggagtttgttagatctattgtcaaggaagtcgccgggttggctccatacgagagaagattgcttgatttgatcagaaactctggtgagaagagagccagaaaggttgccaagaagagattgggtacttttggcagagcaaaggctaaggttgaagaaatgaacaacgtcattgctgcttccagacgtcactga
position 219
XM_003644656.1 - Eremothecium cymbalariae DBVPG#7215 - NCBI
Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory protein mRNA. (273 bp)
Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fenglin Road, Shanghai, Shanghai 200032, China atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
position 135
XM_011412523.1 - Metarhizium robertsii ARSEF 23 - NCBI
Kuraishia capsulata CBS 1993 uncharacterized protein (KUCA_T00004322001), partial mRNA. (318 bp)
atgatacaacaacgctttgaggttgaagacagtatcgccgctggtgttaacaagggtcacaaagtgaccgctaaggaggttgccccaaaaatctcgtacagaaagggtgctttgtccaagagaaccgccttcgtcagagacattgtccgtgaagtgtccggtttggctccatacgagagacgtgtcattgagttgatcagaaatgctggtgagaagcgtgccaagaagctggccaagaagagattgggaactcacttgagagccaaggccaaggttgaggagatgaacaagatcatccaagagtctagacgtcactaa
position 234
XM_022601045.1 - Kuraishia capsulata CBS 1993 - NCBI
Echinococcus granulosus hypothetical protein (EGR_02867), partial mRNA. (285 bp)
Key Laboratory of Health and Disease Genomics, Chinese National Human Genome Center at Shanghai, No. 250 Bibo Road, Shanghai 201203, China atgtcaatttatgtggagcaaatgaggtcaaaatacacgtatttacgaatacgtatgcaacgttctaattcggtttgtcgcagtacgacttcaaaaaccaagtggtatttgtccttttgtcactggatggcagttgtttatggcagagtgtcaagaagagattggttggattctaagcaccaaataaatcaagaacttgaggatgcattagcatcactagccaaaccacaatctccctcaggacaaatgagggcaataagcttgaagaatttaccttctctgtga
position 152
XM_024492116.1 - Echinococcus granulosus - NCBI
PREDICTED: Prunus persica uncharacterized LOC109948414 (LOC109948414), ncRNA. (315 bp)
including 8 samples with support for all annotated introns" /db_xref="GeneID:109948414" ncRNA 1..315 /ncRNA_class="lncRNA" /gene="LOC109948414" /product="uncharacterized LOC109948414" /db_xref="GeneID:109948414" ORIGIN // gcaaagtcgacagtaatgtgcaacaatcaagagttggccgagatgcattttttaatttcatgtacaagaagagattgctaataaatggaggaaattaaaccttaaagagaaggctacatatggttctgccttggaaggttcgagtgggccaaggattaaaatatcaaccatgtaaataatatagggcctccaatttacggatatttcgggggatatattattatcgtcttaggtatcggaaaaaagaagaagacagatataggtattgaaacacataattttggtataaaactttcattaatgttatgtacatta
position 65
XR_002271033.1 - Prunus persica (peach) - NCBI
PREDICTED: Papilio machaon 40S ribosomal protein S4-A-like (LOC106708482), partial mRNA. (348 bp)
gcttctagaaaagtcgttgatttcattccttttgagactgataaagttgtttacgtcataagaggagaagatatgggaagagtgtgtgttattaaacacatcaaagaagttgattattctgattctattattacagttgaggattttgctaagaaggtctttactgttccttctaagaatctcattgtcatcggtaacagtgaagataatcttttgatttctctaccagcacagagaggaattaaactcaatgaacttgaagagagtaatattaagtacggagagatagtaaaacaagaagagattgagattgaagaagaatattaa
position 316
XM_014500008.1 - Papilio machaon (common yellow swallowtail) - NCBI
Spathaspora passalidarum NRRL Y-27907 hypothetical protein (SPAPADRAFT_55114), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
position 216
XM_007374654.1 - Spathaspora passalidarum NRRL Y-27907 - NCBI
[Candida] pseudohaemulonii 60S ribosomal protein L36 (C7M61_002398), partial mRNA. (300 bp)
Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggtcgaggagatgaaccagatcatcactgagtccagaagacactaa
position 216
XM_024857773.1 - [Candida] pseudohaemulonis - NCBI
PREDICTED: Rosa chinensis uncharacterized LOC112180120 (LOC112180120), ncRNA. (366 bp)
coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:112180120" ncRNA 1..366 /ncRNA_class="lncRNA" /gene="LOC112180120" /product="uncharacterized LOC112180120" /db_xref="GeneID:112180120" ORIGIN // ctcaagaagagattgatgtagttcgaatagaatgggcagagcaggttgatggatatattgaagatgaagtaaaatagtcagcatagattgcaagcatgttgatatcactgtaggaaaaatttagaaagtaaagttccagatattgcaaaatatggatttacatcggcatggttgccgccatcaactcattcctttgccccggaaggttacctccttcagaacatatattccctcaattctaaatatggatctcagcgccaattaagaggtttactaaaaaaaattgggttacctccctcagaacatatattccat...
position 3
XR_002928116.1 - Rosa chinensis - NCBI
Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36B (RPL36B), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagccccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatatgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
NM_001184312.1 - Saccharomyces cerevisiae S288C - NCBI
Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36A (RPL36A), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
position 219
Synonym: RPL39B
NM_001182701.1 - Saccharomyces cerevisiae S288C - NCBI
PREDICTED: Calypte anna zinc finger protein 420-like (LOC103535473), partial mRNA. (1339 bp)
ttcacccggagcttccaccataagaggcacctccggagggcgcaggcccgtggggggtggccctgtgcaaagagcccccccggcaagagaaacgggagaaacgggagaaacgggcacgagtggagcgaggggcaagaggggagcaagggccaagagttggccacgggtcaagagttggccaagggtcaagaccctctctccactcaagagttggccaagggccaagagaagaccaaggggcaagaggagattgagggccaagagttgaccaagagtcaagagttgaccaagggtcaagaagagattgagggccaagagttgaccaagggcctagagaagaccaaggggcaagagttgaccaagagccaagagttgaccaagggtcaagaggagattgacggccaagagttgaccaagaaccaagagttgaccaacggccaagagtcagccaatccccaggccctccccggcgccgccctgctgatccgacacccgtgtccccccctcaccaagaagccctacgggtgcccccactgcgggcggaggaggcacctccggagggcgcaggcccgtggggggtggccctgtgcaaagagcccc...
position 494
XM_008501529.1 - Calypte anna (Anna's hummingbird) - NCBI
PREDICTED: Brassica napus uncharacterized LOC111205670 (LOC111205670), ncRNA. (360 bp)
ncRNA 1..360 /ncRNA_class="lncRNA" /gene="LOC111205670" /product="uncharacterized LOC111205670" /db_xref="GeneID:111205670" ORIGIN // aatgagaatttaaagtttacagattttgtttaatattgagctataaatggtatatacaaaaacaggggtataaactattaagaggcttctctctagcaaatgaaaaaaatccagtaaaggtttttcttttttttttttgtgcacaagaagagattgaagccaagaaaaaaaaacccagaaacttcctttgaggaaattcaaatctgaaaaaaaaacaaagaaaacagtttcctgataattaaaaatcaaaccaaaagaagagaagttttctaagagataatttgtttttctttcttttctctttttttttggtttggttccttgtgctatcagtctattacaatccaatagaaaagagaa
position 144
XR_002658213.1 - Brassica napus (rape) - NCBI
PREDICTED: Limulus polyphemus uncharacterized LOC111086280 (LOC111086280), ncRNA. (365 bp)
product="uncharacterized LOC111086280" /db_xref="GeneID:111086280" ORIGIN // gtggaatgaaatcagatttgaatttaaccacctgagcaaactactactttgaatgataagaatgaaccatcactactggaaacgttataccgaagcaaggatactctggaaaccatatttaggtttatcgatagagatgggtcaggtcttatctccatggaagaatttacagatgcatgccatctactaagtcaacacttagggacagctatgtcacaagaagagattgatgatttggccaagagtatagacattaacaaagacggatttattgatttcaatgagtttttggaagccttccgtcttgtagacaaggagccctcccctgtattacaggcaagagagtaaacattgttcttgtggta
position 217
XR_002611008.1 - Limulus polyphemus (Atlantic horseshoe crab) - NCBI
Caenorhabditis remanei hypothetical protein (CRE_18336) mRNA, partial cds. (2351 bp)
cttggaaggataaacgaagaacatgaacatgacgatgaagatgacgaagttcagaccgagagtagctcagacagcatgataatgcatgagaactcttccgagccaataatgcaattgaatgtcgaagaatacatccaaacaatgattgaaaaactgagcagtcatcattcgatacatgaagcaccaagattctcgtgcaagaaactatggtccaccttcgcttatgatcgatcttcacctttgttggaacctgtcgaagagccgattttcgaaaagaaagaaccggaactgactcaagaagagattgatcacatcgtttggattcaaagtctagctgagcagtcatcattcgaacaagcagcacctccgactcgtccaccagttcctcaaagaatggcaacagttgaagaaccaattgctacgaccgatcttcatgaagaggacagatccagtgcaacatcaggagctgacatcgaacaatccttggatcaagaagtcgcttatgatcgatcttcacctttgttggaacctgtcgaagagccgattttcgaaaagaaagaaccggaactgactcaagaagagattgatcacatcgtttgg...
position 1624
XM_003089063.1 - Caenorhabditis remanei - NCBI
PREDICTED: Dendroctonus ponderosae bis(5'-adenosyl)-triphosphatase-like (LOC109546646), mRNA. (376 bp)
misc_feature order(171..173,177..179,183..191) /gene="LOC109546646" /note="HIT family signature motif; other site" /db_xref="CDD:238263" misc_feature 177..179 /gene="LOC109546646" /note="catalytic residue [active]" /db_xref="CDD:238263" ORIGIN // tggtatccactataagacgagtacagaggctgcatgacatgacccaagaagagattgctgatcttttccagaccgccgttaaaatttctaaaattatggaagcggcttaccaagccgcatcaagcacggtttgtgtccaggatggcgaatatgccggccaaactgccccgcaagtgcacgtgcatattttaccacgcaaaaagggcgactttgccaacaatgacgatatttattcgcgtctggccgaccaggacagagacaccaatccgacgtccagaagaacactggaggaacaagtggaagaagccgcttatctaagaacgttttttctttgatcagtgtgaaatttgttg...
position 45
XM_019917686.1 - Dendroctonus ponderosae (mountain pine beetle) - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (411 bp)
Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan tcaactggagtcaaacttgcaaacaattgtatggagattttcgatcagatgaagattcgtcgtcaatatggaatagtcttttataagttgaacgatgacaatactcagattgtggtcgagaagactttaccatatggatcaccattcactactttcctcaccgagctacctcccactgaatgtagatacgtcttagttgactttgcctacaccgaagagtcaacctccaagaagagattggtgttcgtctcatggtgtccaggtacatcaagtattagaagtagaatgatatatactgcttcaaaggatgcacttcgcaaggcattggttggtatccaaactgaggtccaaggttgtgatatatctgaggtccaagaggaacaattccttgagaagatcacgaggttgtag
position 228
XM_012898411.1 - Acytostelium subglobosum LB1 - NCBI
PREDICTED: Solanum tuberosum F-box/LRR-repeat protein At3g48880-like (LOC107062341), mRNA. (420 bp)
translation="MSFPKQEEIEVVVMEEGTSPVRIWEDLNIDMLVKIFQSFDLFQLISVIPQVCHAWQSACSDQHLWKTLDLSIMKSNFIRVSIPPYIYVDTPSREKLNRILKICLILSHGNKLTLIFHYNLYVDNNQLTYSAKRYSPNKL" misc_feature 70..213 /gene="LOC107062341" /note="F-box-like; Region: F-box-like; pfam12937" /db_xref="CDD:289689" ORIGIN // atgtcgtttccaaaacaagaagagattgaagttgttgtgatggaagaaggaacttctcctgtaaggatatgggaggaccttaatattgatatgctggtgaagatattccaatcctttgaccttttccagttgatctctgtcattcctcaagtttgtcatgcatggcaatcggcttgttctgaccaacatctttggaaaacgctggacttgtcaataatgaagtcaaatttcatcagagtttcaataccgccgtatatatatgttgacactccatctcgtgaaaaattgaaccgcatcctaaagatttgcttgatccttagtc...
position 16
XM_015312875.1 - Solanum tuberosum (potato) - NCBI
Neurospora tetrasperma FGSC 2508 hypothetical protein partial mRNA. (354 bp)
TITLE Direct Submission JOURNAL Submitted (06-APR-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atgcttcgtttctcgtttcccggcgagtccgcattgcaatccatcaagatggaggaagcctctggttgcaacgagcgtgattttgaatacacatctgccgacaaacgagatgtttgcacagagtcggtgatgcctgcaagaagagattgtgtgggcgatggcttctatcaaaccaaattctctgcacaaaagagcgaggcgctgaagtgcgtccgtgtgatgagaatggatcatggaacagagaacaacttccccgggacccggcccatgtggagatctcggctcattcttccgttggctgatcttgttatgtatgtacatcgctatttggggtttacaggccatttcagctga
position 137
XM_009852508.1 - Neurospora tetrasperma FGSC 2508 - NCBI
PREDICTED: Prunus persica uncharacterized LOC109949103 (LOC109949103), ncRNA. (395 bp)
product="uncharacterized LOC109949103" /db_xref="GeneID:109949103" ORIGIN // tgtgatgttgtggtgtttacgggggtgggggtattaggctttggattagtattcaaattctcggcgctatagacaattgcatgatagtgttttgtacttgatttgtgcaagttatggaagctcaaaaaaggggatcaacaaaaggaaagcgcaaagtcgacagtaatgtgcaacaatcaagagttggccgagatgcattttttaatttcatgtacaagaagagattgctaataaatggaggaaattaaaccttaaagagaaggctacatatggttctgccttggaaggttcgagtgggccaaggattaaaatatcaaccatgtaaataatatagggcctccaatttacggatatttcgggggatatattattatcgtcttaggtatcggaaaaaa
position 215
XR_002271587.1 - Prunus persica (peach) - NCBI
PREDICTED: Eurytemora affinis BBSome-interacting protein 1-like (LOC111709665), mRNA. (433 bp)
Region: BBIP10; pfam14777" /db_xref="CDD:317216" ORIGIN // attgtgacacctatatattttaagaaatatgtattaaaatctatagaatgagtgaagacaagaatagatttcctgaactagtaaaccctgttctaccaaaacgtggattagtttatcaagaaagtaatcctcaactagttctctgcaagccaaagcttctgcccctgaagtctatgaccctggagaagatggaaaggatgcagaaggaggcgaacgagaaggcgaaggaaatgcaagaagagattgagaaagagaaacaggctgggttcactgataccatagggtccgaagagaccgcagatgttttaacattagatgacgattagatgatacttcagaaaacactagaatctcaaaatcaattaattgcagttttttccagaaaagtgaactgaaaactttgttaattgtgttaatgggaaattctaacaaa
position 234
XM_023483453.1 - Eurytemora affinis - NCBI
PREDICTED: Drosophila biarmipes uncharacterized LOC108029766 (LOC108029766), mRNA. (433 bp)
xref="GeneID:108029766" /translation="MASATSSSARHLFDESKKRLCARVGVNVNNLGSVARQVVRGSKSNEIMHQTLKNFTQVDVVSEYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVTAMER" ORIGIN // ttaaatattttatctcagctgtttctccctgactttgtttacaattagcgagtttattaacatttaaacagcgttaaaccataaataaaatggcctctgcgaccagttcaagtgctcgacatttattcgacgagtccaagaagagattgtgtgcccgcgtgggtgtaaacgtgaataatttgggatctgtggcccgacaggttgtcaggggctccaagagcaacgagatcatgcatcaaaccctgaagaacttcacccaagtggacgtggtctcggaatacagccaccagaatctgcagaagatgacgctgatcctgcagcacgtgggctaccagtacgatgtgatgcaggatagtgtcaaccacttggattacctcaaggagcaggtgacggccatggaaagatgattggaagagcaaaagcctagacacta
position 137
XM_017102272.1 - Drosophila biarmipes - NCBI
PREDICTED: Chrysemys picta bellii uncharacterized LOC112059450 (LOC112059450), ncRNA. (442 bp)
annotated introns" /db_xref="GeneID:112059450" ncRNA 1..442 /ncRNA_class="lncRNA" /gene="LOC112059450" /product="uncharacterized LOC112059450" /db_xref="GeneID:112059450" ORIGIN // acctccacaacctcacatgacatttcacccagctactcctgtactgagcccaataattggtttatctaaagcatctcttccagaaaggcatccagtcttgaagtgaagacaagaagagattgagaatccaccatatcccttggtggcttgttccagtggttaccccttagctttcatagactgtgatgctataattcctggacagaggaaatctaagtaaagcagccatcttgtacagaatgtgatggaaaagggctagaatgagaatttcttctcatccatcagatctgatgaagtctataaaaccatgaatggtgtggaaaaagtgaatagagaagagttatttgccctttcccacaatactaaaaacagtttaaggctgaatttgattctcatgaaaatgagcaacaatctgtact...
position 110
XR_002888767.1 - Chrysemys picta bellii (western painted turtle) - NCBI
PREDICTED: Capsicum annuum uncharacterized LOC107858853 (LOC107858853), mRNA. (438 bp)
ORIGIN // atgaatggagtagttaaagctgcaaatcttaattatggtggatattgcaccacaattagaacttctactggggaaactccctacatgttggtttatgggtcggaagcagtgatacctacagaagtagagataccttcattgagagtcattcaggaggttggtctagatgacgttgaatggattcatagtagaatcgagcagttgatgctcattgacaagaagagattggatgcggtttgtcatggtcaactctatcaaaatagaatgatcaaggcgttcaacaagaaagtcaagcctcgtcgattcacaccaggacaattagtattgaagaagatattccctcaccaagatgaagccaaaggaaaatttgtgccaaattggcaaggtccttacatagttcaccgagtactctcaggaggagcagtgatcctcgcataa
position 216
XM_016703657.1 - Capsicum annuum - NCBI
PREDICTED: Cricetulus griseus uncharacterized LOC103163642 (LOC103163642), transcript variant X2, ncRNA. (439 bp)
transcript variant X2" /db_xref="GeneID:103163642" ORIGIN // ttgtacttgtggtatagactgctgcatgctggctggctaggttgctctttttaacttagaaagttgaggaaacaacaaagtagaggatgaatggtatctggaggttgacatactgatactcggggaaggtacagatgtgaatttcagcatgaagaaaggaagatattttctgttgttcaaggatgagacataccatatgagagggagccactataggtccaagaagagattgggaccatggagatttccagagacctacaaggatgacatgatctcataatcaaggcaatggtggagaggataacctaaaagccctcccctaaaatgagattgatgatttctctttatgccatcctagagcactcatccagtggctgatggaagcagatacagacatccacagatatacactgagctgaaattgggaatttagttgaag
position 220
XR_481632.1 - Cricetulus griseus (Chinese hamster) - NCBI
Cryptosporidium muris RN66 prefoldin subunit 2, putative, mRNA. (372 bp)
Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA REFERENCE 2 (bases 1 to 372) AUTHORS Silva,J.C. TITLE Direct Submission JOURNAL Submitted (02-MAY-2007) The Institute for Genomic Research, 9712 Medical Center Drive, Rockville, MD 20850, USA atggttgagacaggatatactaaggagacacaagaagagattgttcaactagataagaaactcaaactactaaacaataagatttcagagcttactcaagatagtaaagagtatggtctagtcttaaatgcatttgagaaggtagacgagaaccgacgatgttttagagttattggtggtgtgatggttgagagaaatgttaaaactgttaaacctgctcttgaaaaagaaaagagtgcgttagatagtgcaatttccgaattagagaagcagtatgaatctattgaagaggaaatgaagaatctaattgagaaatatagtacaaatagtgctgatcc...
position 31
XM_002141116.1 - Cryptosporidium muris RN66 - NCBI
PREDICTED: Morus notabilis uncharacterized LOC21408890 (LOC21408890), mRNA. (456 bp)
gacaacaaacttcaggagtctcaaaaatggcttgaagatcattcaaagggcgtcataggaagtgaattggtgacttcaactttggagggccttcaggtggttgcatcccatgaaggctttttccgctgtcacttccttgtaccgagtagccttttggatcaacgtggaaactggcacatcggagcgatagccacgttgatcgatagcgtaggcgccgccacggcacactcgttgtttggtcccatcagagcatccgttgactttatcatctcatacttctcaacggctaagtttcaagaagagattgagatagaggccaaggctgtaagaggacaaggaaagcttgtagggtttatggtggaagtgaaaagaaaaggtagtggagaattgattgccattggtaagcaatggatggcctcaaaaggtcaagagaaaagtagtaggctttga
position 301
XM_024166711.1 - Morus notabilis - NCBI
Encephalitozoon intestinalis ATCC 50506 calmodulin (Eint_091500), partial mRNA. (423 bp)
caactatttgcagagtcgcccactgagagagttcccaccgacaggttgggagatatcttgaggtttgcaggatacatcatatctgaaagttatgcagaagagctcatggcctcagttcctggagagatgtttgacttcagccagcttgtagagatctgcgagaaaatccgggaaagagagataacacgcgaggaactgcaaaagtcctttcgaagactggatgcagaaaatacctcgcacatcgatgcaggaaggcttgtccagattctttcttctggagaaaataagtttagtcaagaagagattgaagagcttttgaacattttgaatcccgatggagacgggaagatttgctatgacttgatcatcaagaacatatttggatactaa
position 328
XM_003073592.1 - Encephalitozoon intestinalis ATCC 50506 - NCBI
Candida tenuis ATCC 10573 ribosomal protein L36e (CANTEDRAFT_125240), mRNA. (383 bp)
Mitchell Drive, Walnut Creek, CA 94598-1698, USA aactactagaacgttaataatggttaagtcaggtattgccagtggattaaacaagggtcacaaagtcaccccaaaggatgtcaagccaaagatctcttacagaaagggtgctttgtccaagagaaccgtctttgtcagagacatcgtcaaggaagttgccggtttggccccatatgaaaagagattgatcgaattgatcagaaacgctggtgaaaagagagctaagaagttggccaagaagagattgggtactcacaagagatctttaaagaagattgaagacatgaacaaggtcatcgctgaagccagaagacactaaacatactttcaaagtcttttaaatcataacatctgatgtacaaataatataagtcaacattcta
position 235
XM_006688023.1 - [Candida] tenuis ATCC 10573 - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/caagaagagattg
lang : en | div : | spe : | query_string : caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.071 | 0.071 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(nt:caagaagagattg)?to=0&format=json
0.108 | 0.036 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(nt:caagaagagattg)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.113 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]