GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-07-25 07:30:05, GGRNA : RefSeq release 81 (Mar, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Caenorhabditis elegans Uncharacterized protein (tag-80), partial mRNA. (25584 bp)
position 1740
NM_001307220.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Uncharacterized protein (tag-80), partial mRNA. (26769 bp)
position 1740
NM_001307219.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Medicago truncatula Nodule Cysteine-Rich (NCR) secreted peptide partial mRNA. (165 bp)
International Medicago Genome Annotation Group TITLE Direct Submission JOURNAL Submitted (21-FEB-2014) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr., Rockville, MD 20850, USA atgatcttttatcatgttttaataacgttgttttgttatctttttttcattacaatacaatttctaccatctccatgtgaaactgatgatgattgtcaagaagagattggtgttagaaaaatatgtattcgtgaagtttgtagatattttgcaaagattcactga
position 96
XM_013598736.1 - Medicago truncatula (barrel medic) - NCBI
Caenorhabditis elegans Unclassified non-coding RNA ZK1193.9 (ZK1193.9), ncRNA. (133 bp)
AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA gaaggcgaccacgtcgtcgccaagaagagattgaagacgacgaatggagcgaaagtagtaaggaggggttgagggggggggaggtcgggatcgagatggcataatgtaggaaccggatggaagagtctaaaag
position 20
NR_070329.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory protein mRNA. (273 bp)
Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fenglin Road, Shanghai, Shanghai 200032, China atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
position 134
XM_011412523.1 - Metarhizium robertsii ARSEF 23 - NCBI
Exophiala aquamarina CBS 119918 hypothetical protein partial mRNA. (288 bp)
Cambridge, MA 02142, USA atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
position 261
XM_013407183.1 - Exophiala aquamarina CBS 119918 - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (297 bp)
Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc
position 63
XM_012897535.1 - Acytostelium subglobosum LB1 - NCBI
Saccharomyces eubayanus RPL36B-like protein partial mRNA. (246 bp)
of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atgactccagctccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcatcagagccaaggctaaggtcgaggaaatgaacaacatcatcgctgcttctcgtcgtcattaa
position 161
XM_018368212.1 - Saccharomyces eubayanus - NCBI
Caenorhabditis elegans Uncharacterized protein (F29B9.11), partial mRNA. (267 bp)
Genome Institute at Washington University, St. Louis, MO 63110, USA atgctgaaccgtgctgtgctctccttggctagaagccaacatgtcatccgtcgctcgcttcacaagggagttgactcgaccccaccactccgtttcacctctgtcagcgagaaggttgccctttacggactcatctgcgtcgctttcatggcatacccaacttccgtcctcttcagacttgatagtcttcgcccaagaccggataatgctctctccccagaagtccaagaagagattgacgcccgtgttgccgcccgcagacagtag
position 225
NM_068208.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Komagataella phaffii GS115 60S ribosomal protein L36 partial mRNA. (306 bp)
/ Gent University, Technologiepark 927, Ghent, 9052, BELGIUM atgagaaatattgtactaacaaattcaggtattgcagtaggtgctaacaagggacacaaggtcaccccaaaggccgttgctccacaaaagagagtcgctatcagccaaagaactgactttgttagaaagttggtccgtgaggtcactggtctgtctccatacgaaagaagaatcattgagttgatcagaaactctggtgagaagagagccagaaagttcgccaagaagagattgggtactcacaccagagctaaggctaagttggaagagatgcaaaacgttatccaggaagcaaagcgtcattaa
position 221
XM_002490801.1 - Komagataella phaffii GS115 - NCBI
Saccharomyces cerevisiae S288c ribosomal 60S subunit protein L36B (RPL36B), mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagccccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatatgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 218
NM_001184312.1 - Saccharomyces cerevisiae S288c - NCBI - UCSC - SGD
Saccharomyces cerevisiae S288c ribosomal 60S subunit protein L36A (RPL36A), mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
position 218
Synonym: RPL39B
NM_001182701.1 - Saccharomyces cerevisiae S288c - NCBI - UCSC - SGD
PREDICTED: Papilio machaon 40S ribosomal protein S4-A-like (LOC106708482), partial mRNA. (348 bp)
position 315
XM_014500008.1 - Papilio machaon (common yellow swallowtail) - NCBI
Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 ribosomal protein L36e partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggcccaaaccggtattgctgtcggtttgaacaagggtcacaaaaccacccaaaaggaagttgttccaagactttcccgcaagaagggagtcttgtccaagagagctgctttcgtcagaagcattgtctctgaggtctccggcttggccccatacgagagaagattgatcgagttgatcagaaacgccagcgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaggagatgaacaagatcattgctgagtctaagagacactaa
position 215
XM_018858572.1 - Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 - NCBI
Saccharomyces eubayanus RPL36A-like protein partial mRNA. (303 bp)
Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
position 218
XM_018367307.1 - Saccharomyces eubayanus - NCBI
PREDICTED: Solanum tuberosum F-box/LRR-repeat protein At3g48880-like (LOC107062341), mRNA. (420 bp)
translation="MSFPKQEEIEVVVMEEGTSPVRIWEDLNIDMLVKIFQSFDLFQLISVIPQVCHAWQSACSDQHLWKTLDLSIMKSNFIRVSIPPYIYVDTPSREKLNRILKICLILSHGNKLTLIFHYNLYVDNNQLTYSAKRYSPNKL" misc_feature 70..213 /gene="LOC107062341" /note="F-box-like; Region: F-box-like; pfam12937" /db_xref="CDD:289689" ORIGIN // atgtcgtttccaaaacaagaagagattgaagttgttgtgatggaagaaggaacttctcctgtaaggatatgggaggaccttaatattgatatgctggtgaagatattccaatcctttgaccttttccagttgatctctgtcattcctcaagtttgtcatgcatggcaatcggcttgttctgaccaacatctttggaaaacgctggacttgtcaataatgaagtcaaatttcatcagagtttcaataccgccgtatatatatgttgacactccatctcgtgaaaaattgaaccgcatcctaaagatttgcttgatccttagtc...
position 15
XM_015312875.1 - Solanum tuberosum (potato) - NCBI
Caenorhabditis remanei CRE-TAG-80 protein (Cre-tag-80) mRNA, complete cds. (21927 bp)
position 1866
XM_003107901.1 - Caenorhabditis remanei - NCBI
PREDICTED: Jatropha curcas uncharacterized LOC105645482 (LOC105645482), mRNA. (402 bp)
db_xref="CDD:252133" ORIGIN // atgaagtccaaggggatggaccaatatgttgacctagatgatgatgatgacgaggagctagagttgaaacaagctaccctcgtgacttacaaaatgccaaaagtggtgaagtatgatggtagtggtgacccgaaggtgcaccttatgcagtacaagtctatcatggaactggcgggtctacagtcaagggaagttttaaagatgttcccaatgtccttaatggggtctgcccaaacttggtattacaatcttgagaagagagcaagaagagattggaatgagcttaccacggttttcctcaaagaatgcgcttataatctccaagtgagtgttaatttgagagatttagaagcaactatgcaaaaacaagacgagacctttacagattatatggctcgatag
position 262
XM_012231086.1 - Jatropha curcas - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (411 bp)
Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan tcaactggagtcaaacttgcaaacaattgtatggagattttcgatcagatgaagattcgtcgtcaatatggaatagtcttttataagttgaacgatgacaatactcagattgtggtcgagaagactttaccatatggatcaccattcactactttcctcaccgagctacctcccactgaatgtagatacgtcttagttgactttgcctacaccgaagagtcaacctccaagaagagattggtgttcgtctcatggtgtccaggtacatcaagtattagaagtagaatgatatatactgcttcaaaggatgcacttcgcaaggcattggttggtatccaaactgaggtccaaggttgtgatatatctgaggtccaagaggaacaattccttgagaagatcacgaggttgtag
position 227
XM_012898411.1 - Acytostelium subglobosum LB1 - NCBI
Spathaspora passalidarum NRRL Y-27907 hypothetical protein (SPAPADRAFT_55114), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
position 215
XM_007374654.1 - Spathaspora passalidarum NRRL Y-27907 - NCBI
PREDICTED: Dendroctonus ponderosae bis(5'-adenosyl)-triphosphatase-like (LOC109546646), mRNA. (376 bp)
codon_start=1 /product="bis(5'-adenosyl)-triphosphatase-like" /protein_id="XP_019773245.1" /db_xref="GeneID:109546646" /translation="MTQEEIADLFQTAVKISKIMEAAYQAASSTVCVQDGEYAGQTAPQVHVHILPRKKGDFANNDDIYSRLADQDRDTNPTSRRTLEEQVEEAAYLRTFFL" ORIGIN // tggtatccactataagacgagtacagaggctgcatgacatgacccaagaagagattgctgatcttttccagaccgccgttaaaatttctaaaattatggaagcggcttaccaagccgcatcaagcacggtttgtgtccaggatggcgaatatgccggccaaactgccccgcaagtgcacgtgcatattttaccacgcaaaaagggcgactttgccaacaatgacgatatttattcgcgtctggccgaccaggacagagacaccaatccgacgtccagaagaacactggaggaacaagtggaagaagccgcttatctaagaacgttttttctttgatcagtgtgaaatttgttgaaat...
position 44
XM_019917686.1 - Dendroctonus ponderosae (mountain pine beetle) - NCBI
Encephalitozoon intestinalis ATCC 50506 calmodulin partial mRNA. (423 bp)
position 327
XM_003073592.1 - Encephalitozoon intestinalis ATCC 50506 - NCBI
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X2, ncRNA. (415 bp)
for all annotated introns" /db_xref="GeneID:105371333" ncRNA 1..415 /ncRNA_class="lncRNA" /gene="LOC105371333" /product="uncharacterized LOC105371333, transcript variant X2" /db_xref="GeneID:105371333" ORIGIN // ccagggtggactgaggctggagcgtgcgacctcagccgcgggtgggcgtcaggggcgaccccggagcgaggggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggagagatt...
position 76
XR_917446.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X2, ncRNA. (415 bp)
variation complement(363) /gene="LOC105371333" /replace="g" /replace="t" /db_xref="dbSNP:374135633" variation complement(395) /gene="LOC105371333" /replace="a" /replace="g" /db_xref="dbSNP:73589841" ORIGIN // ccagggtggactgaggctggagcgtgcgacctcagccgcgggtgggcgtcaggggcgaccccggagcgaggggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggagagattcag...
position 76
XR_933716.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Peromyscus maniculatus bairdii prefoldin subunit 4-like (LOC102907957), mRNA. (472 bp)
position 285
XM_006984001.2 - Peromyscus maniculatus bairdii (prairie deer mouse) - NCBI
PREDICTED: Pongo abelii uncharacterized LOC100448557 (LOC100448557), ncRNA. (322 bp)
position 284
XR_653668.1 - Pongo abelii (Sumatran orangutan) - NCBI
PREDICTED: Drosophila biarmipes uncharacterized LOC108029766 (LOC108029766), mRNA. (433 bp)
xref="GeneID:108029766" /translation="MASATSSSARHLFDESKKRLCARVGVNVNNLGSVARQVVRGSKSNEIMHQTLKNFTQVDVVSEYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVTAMER" ORIGIN // ttaaatattttatctcagctgtttctccctgactttgtttacaattagcgagtttattaacatttaaacagcgttaaaccataaataaaatggcctctgcgaccagttcaagtgctcgacatttattcgacgagtccaagaagagattgtgtgcccgcgtgggtgtaaacgtgaataatttgggatctgtggcccgacaggttgtcaggggctccaagagcaacgagatcatgcatcaaaccctgaagaacttcacccaagtggacgtggtctcggaatacagccaccagaatctgcagaagatgacgctgatcctgcagcacgtgggctaccagtacgatgtgatgcaggatagtgtcaaccacttggattacctcaaggagcaggtgacggccatggaaagatgattggaagagcaaaagcctagacacta
position 136
XM_017102272.1 - Drosophila biarmipes - NCBI
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X1, ncRNA. (437 bp)
introns" /db_xref="GeneID:105371333" ncRNA 1..437 /ncRNA_class="lncRNA" /gene="LOC105371333" /product="uncharacterized LOC105371333, transcript variant X1" /db_xref="GeneID:105371333" ORIGIN // tgaggcagctgttggagagggatgggtcaagggatggagggtagcactgtgagctgaaataggtgaattgggagggatgctggctagagaagaggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggaga...
position 98
XR_917445.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X1, ncRNA. (437 bp)
gene="LOC105371333" /replace="g" /replace="t" /db_xref="dbSNP:374135633" variation complement(417) /gene="LOC105371333" /replace="a" /replace="g" /db_xref="dbSNP:73589841" ORIGIN // tgaggcagctgttggagagggatgggtcaagggatggagggtagcactgtgagctgaaataggtgaattgggagggatgctggctagagaagaggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggagagattcagggtat...
position 98
XR_933715.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Capsicum annuum uncharacterized LOC107858853 (LOC107858853), mRNA. (438 bp)
ORIGIN // atgaatggagtagttaaagctgcaaatcttaattatggtggatattgcaccacaattagaacttctactggggaaactccctacatgttggtttatgggtcggaagcagtgatacctacagaagtagagataccttcattgagagtcattcaggaggttggtctagatgacgttgaatggattcatagtagaatcgagcagttgatgctcattgacaagaagagattggatgcggtttgtcatggtcaactctatcaaaatagaatgatcaaggcgttcaacaagaaagtcaagcctcgtcgattcacaccaggacaattagtattgaagaagatattccctcaccaagatgaagccaaaggaaaatttgtgccaaattggcaaggtccttacatagttcaccgagtactctcaggaggagcagtgatcctcgcataa
position 215
XM_016703657.1 - Capsicum annuum - NCBI
PREDICTED: Cricetulus griseus uncharacterized LOC103163642 (LOC103163642), transcript variant X2, ncRNA. (439 bp)
transcript variant X2" /db_xref="GeneID:103163642" ORIGIN // ttgtacttgtggtatagactgctgcatgctggctggctaggttgctctttttaacttagaaagttgaggaaacaacaaagtagaggatgaatggtatctggaggttgacatactgatactcggggaaggtacagatgtgaatttcagcatgaagaaaggaagatattttctgttgttcaaggatgagacataccatatgagagggagccactataggtccaagaagagattgggaccatggagatttccagagacctacaaggatgacatgatctcataatcaaggcaatggtggagaggataacctaaaagccctcccctaaaatgagattgatgatttctctttatgccatcctagagcactcatccagtggctgatggaagcagatacagacatccacagatatacactgagctgaaattgggaatttagttgaag
position 219
XR_481632.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Halyomorpha halys uncharacterized LOC106684563 (LOC106684563), transcript variant X2, mRNA. (450 bp)
db_xref="GeneID:106684563" /translation="MERHRLNIDEVMDIVKNEKLPEDKEKQCFVGCTMNNLGYVKDLILDWNEVKKTNPEKFDTPEEVEKANTVADACAKTVSGKHPSLCELGVRAIKCMHQESQKIKLPIPDFSFD" misc_feature <67..339 /gene="LOC106684563" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:279703" ORIGIN // cctgtatacaagaagagattgctatcatcattgaccgattgtatggaaaggcatcgattaaatatagatgaggttatggatatagtaaaaaacgaaaaacttcctgaggataaagaaaagcagtgtttcgttggctgtaccatgaacaatctgggatatgtaaaggatttaatattggattggaatgaggtaaagaagactaatcctgaaaaatttgatacacctgaagaagttgagaaggcaaacacagttgccgatgcttgcgctaaaacggtgtctggaaagcatccaagcctctgtgaactgggagtaaggg...
position 8
XM_014426725.1 - Halyomorpha halys (brown marmorated stink bug) - NCBI
Ostreococcus tauri unnamed protein product (Ot14g02090) mRNA, complete cds. (264 bp)
PUBMED 16868079 REFERENCE 2 (bases 1 to 264) AUTHORS Rombauts,S., Derelle,E., Ferraz,C., Van de Peer,Y. and Moreau,H. TITLE Direct Submission JOURNAL Submitted (30-APR-2005) to the INSDC atgggattggattgcgtgtacgcgcacgccttgctcagtgcggacgacgcggcgatcgaactcgggttcgggacgacgacgttcaagaagagattgagacaacttggagtcaggcgatggcccgggcgtcagtttgcgggcgtcttgaaatgttacgaatacatcgtgactgtactgaatgtgcgtaaagcgacgcgcggatcttgcgtcttctcgaaagcgacgaccgaaccgcggtcaaacgaccgactgaccgatgcgtga
position 83
XM_003082952.1 - Ostreococcus tauri - NCBI
PREDICTED: Fukomys damarensis uncharacterized LOC104865732 (LOC104865732), ncRNA. (417 bp)
ncRNA_class="lncRNA" /gene="LOC104865732" /product="uncharacterized LOC104865732" /db_xref="GeneID:104865732" ORIGIN // tgtagaggagactccagagaactctcctgccttctgccatctgaagacacagtaggaaaaaggacatctgtaaaccagcaaaccattcaaagagaatggatttcagtttgactcaaggagttgcctggctgtgaaatggactacagtaatgatagtcacagaagatggttcaagaagagattggacaaaccaactgaaggagacatcgtgaagaagacttgaataccaggtaggctctatagtcagcacagaatgttcagcacggtccaagaaaatcactgtatactggacctttaggatggtgaaccgaggagctgcgaggctggggtgcttcctggaagaatgagagctaagctcaaagccaggcttctgctcctcgatgctacatgttcaaataaaaaagtatacccctggcct
position 170
XR_781255.1 - Fukomys damarensis (Damara mole-rat) - NCBI
PREDICTED: Brassica napus uncharacterized LOC106394613 (LOC106394613), ncRNA. (470 bp)
with support for all annotated introns" /db_xref="GeneID:106394613" ncRNA 1..470 /ncRNA_class="lncRNA" /gene="LOC106394613" /product="uncharacterized LOC106394613" /db_xref="GeneID:106394613" ORIGIN // tgcatattttcctcagcctgaagaaagacgcgtcctcatttctacggacatgcggatggtatgatcaagtacactcctccatgcgtgccaagaagagattgtgttcagagcaatcaggaggagatggggaagatagcaacgacttaaagaggaggttgataggagatgtaaaatcaagttcccttcagattccagatgaattgaaagcgcatcttgtaaaccggctccggaaaattggcaagaagaaatactcgtgaaccattcatggtttgcttaaccggttaaaagtctctacgtggtccctctatactctcctctgtcctcagtttcatcacatcgctcccgttggttgtgtgagatacagagagaacggacggagatttttttttcctgtgagg...
position 88
XR_001278934.1 - Brassica napus (rape) - NCBI
PREDICTED: Columba livia cytochrome P450 2C31 (LOC102094641), partial mRNA. (470 bp)
position 375
XM_005515875.2 - Columba livia (rock pigeon) - NCBI
PREDICTED: Calypte anna zinc finger protein 420-like (LOC103535473), partial mRNA. (1339 bp)
position 493
XM_008501529.1 - Calypte anna (Anna's hummingbird) - NCBI
Saccharomyces cerevisiae S288c ribosomal 40S subunit protein S23A (RPS23A), mRNA. (438 bp)
submitter REFERENCE 7 (bases 1 to 438) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgggtaaaggtaagccaagaggtttgaactctgctagaaagctacgtgtccacagaagaaacaaccgttgggccgaaaacaactacaagaagagattgttgggtactgccttcaagtcttctccattcggtggttcttctcatgccaagggtatcgtcttggaaaaattgggtatcgaatccaagcaacctaactctgctatcagaaagtgtgttagagttcaattaatcaagaacggtaagaaggtcactgctttcgttccaaacgatggttgtttgaactttgtcgacgaaaatgatgaagtcttgctagcaggtttcggtagaaagggtaaagctaagggtgatattccaggtgttagattcaaggtcgttaaggtctctggtgtctcc...
position 86
NM_001181247.3 - Saccharomyces cerevisiae S288c - NCBI - UCSC - SGD
Cyberlindnera jadinii NRRL Y-1542 ribosomal protein S12/S23 partial mRNA. (438 bp)
H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (23-FEB-2016) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atgggtaagggtaagccaagaggtttgaactccgctagaaagttgagagtccacagaagaaacaaccgttgggctgaacaatcttacaagaagagattgttgggaactgctttcaagtcctctccattcggtggttcttctcacgctaagggtatcgtcttggaaaagattggtattgagtccaagcaaccaaactctgctatcagaaagtgtgtcagagttcaattgatcaagaacggtaagagagttactgctttcgttccaaacgatggttgtttgaacttcgtcgatgagaacgatgaagttttgcttgctggtttcggtagaaagggtaaggctaagggtgatatcccaggtgtcagattcaaagtcgtcaaggtttctggtgtctccttg...
position 86
XM_020212990.1 - Cyberlindnera jadinii NRRL Y-1542 (anamorph: Candida utilis NRRL - NCBI
PREDICTED: Cucumis melo cytoplasmic tRNA 2-thiolation protein 1-like (LOC103490070), mRNA. (471 bp)
position 417
XM_008449439.1 - Cucumis melo (muskmelon) - NCBI
Neurospora tetrasperma FGSC 2508 hypothetical protein partial mRNA. (354 bp)
TITLE Direct Submission JOURNAL Submitted (06-APR-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atgcttcgtttctcgtttcccggcgagtccgcattgcaatccatcaagatggaggaagcctctggttgcaacgagcgtgattttgaatacacatctgccgacaaacgagatgtttgcacagagtcggtgatgcctgcaagaagagattgtgtgggcgatggcttctatcaaaccaaattctctgcacaaaagagcgaggcgctgaagtgcgtccgtgtgatgagaatggatcatggaacagagaacaacttccccgggacccggcccatgtggagatctcggctcattcttccgttggctgatcttgttatgtatgtacatcgctatttggggtttacaggccatttcagctga
position 136
XM_009852508.1 - Neurospora tetrasperma FGSC 2508 - NCBI
Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36, partial mRNA. (288 bp)
US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa
position 203
XM_001383429.1 - Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054) - NCBI
Morus notabilis hypothetical protein partial mRNA. (366 bp)
REFERENCE 3 (bases 1 to 366) AUTHORS He,N. and Zhao,S. TITLE Direct Submission JOURNAL Submitted (19-JUN-2013) Project Design Centre, BGI-Shenzhen, 11f, Beishan Road, Yantian District, Shenzhen, Guangdong 518083, China atgaaatcagcggaaaggattttctatcttgctatcccgctttcgaagcaactcgactattatagggaataccaagaagagattgttgagctagttggggtcgacaacgtttcgttaatttcttctcgtggcatacacatattaagtttaggaaatagtgatttagtgcaaaattactatatcaatcctgttcttaatattgctcagacacctaaagtgcaaaaatttgcaagattcatcaagagcagcgacatcgatatagccccatccgcgtggaagggaattatctctctcaatgaacgtataaaaactattgttggcccacctcctaatagcttaagcttttgggatagattggtaaactaa
position 72
XM_010101849.1 - Morus notabilis - NCBI
Cladophialophora yegresii CBS 114405 hypothetical protein partial mRNA. (501 bp)
Direct Submission JOURNAL Submitted (27-MAR-2013) Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA atgcctccgtcgcatccctctcagcgaggattcacccttcctcctgcgaacacacagtccgcgaagcaagcacgtagcgccttcttctgttcgctatgccagaaaggttacagtcgtatgaacgagttcgaagcgcatgagtcgtcttacgatcaccaacacaagaagagattgaagcagatgaaggaaatgcaacgacaagtccaaccgaaaaaggaagagaagggcccgttgatgcagataaaactcggcggtgcccccaagagtgcgtcaagcggtggcggagggttcaagaagggaggattcaagaacgcattcgctccagccaacgacgagcctagtgttgatgtcaagaaagaggatgaggccgaccccataggtgcagcgccaagtgcgattcaagatgacagcgacgtgacagaggacgaagactactacgacccacgccgaccaacaggttgcacgcctg...
position 161
XM_007759481.1 - Cladophialophora yegresii CBS 114405 - NCBI
Mitosporidium daphniae mitochondrial distribution and morphology protein 34 partial mRNA. (498 bp)
position 423
XM_013382114.1 - Mitosporidium daphniae - NCBI
PREDICTED: Microcebus murinus exo/endonuclease G (EXOG), transcript variant X12, misc_RNA. (462 bp)
endonuclease G, transcript variant X12" /db_xref="GeneID:105866813" ORIGIN // cagagaggtttgaagatgtttgggtagtatctggaccattgaccttacctcaaactagaagtgatggaaagaaagcagttagttatcaggcaatgaagcatatatgtgtttttattttggaggaagtgaaacaaatgaactggcatttattgagggctgtgtatgtcaggtggtatctgaggtcatccatgtgctttctctgatgtgcctgtttcaagaagagattgattccagacaattgaaacatacctgaagattctggcttggacattataaatgacctgacaagaaatcctgcagttggtcttggcagtgggacctccacgtgtgacagacagcagatggctgtggagttcccatgctgtgtgccatgtgattggtgatgacaatgtggcagtcccctcacacctttataaggtgatcctggcccgcagaagcccagtatctactgaacctctggca
position 214
XR_001152030.1 - Microcebus murinus (gray mouse lemur) - NCBI
Populus trichocarpa hypothetical protein (POPTR_0002s05100g) mRNA, complete cds. (378 bp)
Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA atgccaggcaagcgctctcgcttaactcatacgcagagcttcagcgacattggtttcagcaaccaccgacttccgccgtgggatgctggtttcgttgctgatgacacggacgatcagtctctccagaggattatcacggtctcgcctcctcagccgctgctgccagagaaagagaaggatataggaggtggattagtgaagactgagcattttcttgataggtgtggctattgcaagaagagattgaataaaaaacaggatgtctatatgtacggttacttgggtgccttttgtagtcctgagtgccgtgatgcacagattgcaattgataaggcagggcaggaagttcgtggacaatcaatcggaacaaagacttga
position 233
XM_002302069.1 - Populus trichocarpa (Populus balsamifera subsp. trichocarpa) - NCBI
Cyberlindnera jadinii NRRL Y-1542 ribosomal protein L36e mRNA. (474 bp)
position 296
XM_020213128.1 - Cyberlindnera jadinii NRRL Y-1542 (anamorph: Candida utilis NRRL - NCBI
PREDICTED: Loxodonta africana chromosome unknown open reading frame, human C3orf14 (LOC100653741), transcript variant X1, mRNA. (521 bp)
position 503
XM_010589703.1 - Loxodonta africana (African savanna elephant) - NCBI
Candida tenuis ATCC 10573 ribosomal protein L36e (CANTEDRAFT_125240), mRNA. (383 bp)
Mitchell Drive, Walnut Creek, CA 94598-1698, USA aactactagaacgttaataatggttaagtcaggtattgccagtggattaaacaagggtcacaaagtcaccccaaaggatgtcaagccaaagatctcttacagaaagggtgctttgtccaagagaaccgtctttgtcagagacatcgtcaaggaagttgccggtttggccccatatgaaaagagattgatcgaattgatcagaaacgctggtgaaaagagagctaagaagttggccaagaagagattgggtactcacaagagatctttaaagaagattgaagacatgaacaaggtcatcgctgaagccagaagacactaaacatactttcaaagtcttttaaatcataacatctgatgtacaaataatataagtcaacattcta
position 234
XM_006688023.1 - [Candida] tenuis ATCC 10573 - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.082 | 0.082 | count_done;
0.137 | 0.055 | search_done;,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.142 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]