GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-09-25 16:07:43, GGRNA : RefSeq release 212 (May, 2022)



Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Camellia sinensis uncharacterized LOC114289714 (LOC114289714), ncRNA. (1872 bp)
position 920 1141
XR_003638702.1 - Camellia sinensis - NCBI
PREDICTED: Telopea speciosissima uncharacterized LOC122670138 (LOC122670138), ncRNA. (148 bp)
alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:122670138" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC122670138" /product="uncharacterized LOC122670138" /db_xref="GeneID:122670138" ORIGIN // tttctacaagagatggtgtgcgaaacagtttttaatggaaaggaagaacttagtcaatctcttcttgaaagcaagcgaggaagacaagctgaaggtattggaattgtatatgccagatactgaggacatcaatgaagactgatgaatg
position 55
XR_006334132.1 - Telopea speciosissima - NCBI
Caenorhabditis remanei CRE-TAG-80 protein (Cre-tag-80) mRNA, complete cds. (21927 bp)
position 1867
XM_003107901.1 - Caenorhabditis remanei - NCBI
PREDICTED: Citrus clementina protein STRICTOSIDINE SYNTHASE-LIKE 4 (LOC18050416), mRNA. (1112 bp)
position 298
XM_006445687.2 - Citrus clementina - NCBI
Caenorhabditis elegans Protein clarinet (cla-1), partial mRNA. (25584 bp)
position 1741
NM_001307220.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Camelus ferus uncharacterized LOC116657067 (LOC116657067), ncRNA. (330 bp)
gene="LOC116657067" /product="uncharacterized LOC116657067" /db_xref="GeneID:116657067" ORIGIN // accacatcacaaacaaaagtcctaataaaagtcgctgactaggactatcctcgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtacacatgaaagagatgtatttgctcagggtctatcaatcttgttctgcctgttttctcaagtcagcagccttatctttacatttactccactcaatctcttcttgtcattttccctttctgtctgaaaataactacccccaagtctgcaaagcatcatctttgtattccatttcttgttgtaaagagtttgtgacattctgcgagatggacatgctagatcggaagagca
position 193
XR_004311999.1 - Camelus ferus (Wild Bactrian camel) - NCBI
Caenorhabditis elegans Protein clarinet (cla-1), partial mRNA. (27002 bp)
position 1741
NM_001307219.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X2, ncRNA. (319 bp)
GeneID:107512815" ncRNA 1..319 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X2" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacagcaaaacgacgccagacgccgttggtttgtgaacggccctcaccacgcggtggacgacgccccgcagaccggcgcccaaaccctgggagcctgcgaagacctcg
position 115
XR_001597394.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Telopea speciosissima uncharacterized LOC122662367 (LOC122662367), ncRNA. (304 bp)
product="uncharacterized LOC122662367" /db_xref="GeneID:122662367" ORIGIN // acagaacaaactcactcttactgaaaatcaagtttcgggggtgaatgtcttctcgcaaggtttctctggaaatcattttaaggggaaatcttctttccagaaacctgcttatagtttcctagagtccgtgctgccggggaaatcatcttcagcaaaaaccagttatttgcagggaagagagtggaaatgatatacgtggacatcttcaatctcttcttgtactaaatgtttctcaacaagagagacatgtgctgtaagcctgtaactgcgaagaattagatctcgaagggatctatttcgtttt
position 207
XR_006333008.1 - Telopea speciosissima - NCBI
PREDICTED: Citrus sinensis protein STRICTOSIDINE SYNTHASE-LIKE 4-like (LOC102608831), mRNA. (1341 bp)
position 312
XM_006485118.3 - Citrus sinensis (sweet orange) - NCBI
Caenorhabditis elegans Protein suex-1 (suex-1), mRNA. (413 bp)
org REFERENCE 4 (bases 1 to 413) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA aaatgcaatctcttcttgtattctgtcttgccacaattattctatcaaacttcacagaggcttctgcagatttggagacagcttcacaaagtctgaagcatccgaggaatttgggatggaaggctcctgaaggacatcgcgaaaaacgatatggtggatggggaggtggatatccctacggcggctacggtggatatggtggaggttacggtggcggatatggaggcggatacggaggagggtatggcggacgatatggcggaaactatggaagcagctcatggggatcatattcgagttatagttctggtggatacag...
position 6
NM_062648.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Lontra canadensis late cornified envelope protein 1A-like (LOC116858788), mRNA. (414 bp)
ORIGIN // atggggcccaaggtccaaaacaggagctatgaggccttccaggtggcacttgccaaagagaatgaggcagaaaatcaaacttccgactccatcagcgagatgtcctaccagcagaatcagcagcagtgccagtcccctcccaagtgtcccaccccgaagtgccctccaaagtgtcccccaaagtgcccctcaatctcttcttgctgcagtgtcagctctgggggctgctgcagctccagctccgggggtagaagctgctgcagttttggaggtggcagctcctgcctgagccaccacagacgacacaggtcccactgtcacagatgccagagctctggctgctgcagccagccctcagggggctccagctgctgtggagggggcagcagtcagtcctctggaggctgttgctga
position 191
XM_032843692.1 - Lontra canadensis (Northern American river otter) - NCBI
PREDICTED: Cygnus olor uncharacterized LOC121066939 (LOC121066939), ncRNA. (369 bp)
LOC121066939" /db_xref="GeneID:121066939" ORIGIN // agacacacctgatgatttattattttcagtagcttatttgtgaatatgaaaaaatgtctttcttgatattcaccaaatgatataaatgcctttactctccagctcttcattttttctgctcactggtgctttgaatgcagtggaaaggcatttctggtctccatggcttctcttaaatgcacgcagagaagggaacataatagagatgatgagccctagcaaattagccaactgcaatctcttcttgttcagttaacgcgcctgtacagccagataccagccacgggagcaaagggctgtgagaggagatttggagcccaagtataggagtagagaagctctcagctgtttgtagcatgtctagaagca
position 235
XR_005818030.1 - Cygnus olor (mute swan) - NCBI
PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles complex 1 subunit 3-like (LOC124274838), transcript variant X2, mRNA. (1880 bp)
position 649
XM_046710202.1 - Haliotis rubra (blacklip abalone) - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X1, ncRNA. (409 bp)
GeneID:107512815" ncRNA 1..409 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X1" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacaggaaacctctccatgaaagaagaagaaaacaggtttttatcgaataagcagtaaaccagaacgtgacgtgcatccaggcaatccagtgggacatctcacctggacagagccagactggtgcgacctgtcacacacacgttctcgggatgagcaccagcttgtcttcaggtaagaggacttgacggcaccattta
position 115
XR_001597393.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles complex 1 subunit 3-like (LOC124274838), transcript variant X1, mRNA. (1893 bp)
position 662
XM_046710201.1 - Haliotis rubra (blacklip abalone) - NCBI
PREDICTED: Manis pentadactyla uncharacterized LOC118908090 (LOC118908090), ncRNA. (501 bp)
position 439
XR_005023066.1 - Manis pentadactyla (Chinese pangolin) - NCBI
Laccaria bicolor S238N-H82 hypothetical protein partial mRNA. (411 bp)
Wuyts,J., Martin,F. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagc...
position 61
XM_001879458.1 - Laccaria bicolor S238N-H82 - NCBI
Trematosphaeria pertusa uncharacterized protein (BU26DRAFT_500137), partial mRNA. (528 bp)
CA 94598-1698, USA atgaccgacaccgcggactttgagcaattttgcttaactacactctacaatgctattccgatgctcgacaaccccagcgaccggtacgagtggaataatagggtgtgcgattttattgagatttcctctgtcgccgaagatggtgctcctccaccaaacaaagatcaggcaaaggaatggtatcgccgacagaaactctacacagccatgatcatgaagaagctgtcgcacaacgctgcgccgcgaattaaggccttagggatcagtgacgtgcaatctcttcttgaagctgtgcgagagcgcttcaactttagccgcctcaaggacgaggcaatcgaggaagagtaccgatccggccagcggggcaatgagccggcgaaggcgcagcgtgttagcaaccagattcaaactcttacccgccagatattgatatcaccggacgaaaccagatgccagattcacatagacaaggttccgttttgctcattttgtcccaccaaactcgcacagcaacccagaaacatttag
position 274
XM_033826478.1 - Trematosphaeria pertusa - NCBI
PREDICTED: Drosophila subpulchrella uncharacterized LOC119551309 (LOC119551309), mRNA. (513 bp)
position 389
XM_037860603.1 - Drosophila subpulchrella - NCBI
PREDICTED: Acropora digitifera uncharacterized LOC107337268 (LOC107337268), ncRNA. (444 bp)
including 41 samples with support for all annotated introns" /db_xref="GeneID:107337268" ncRNA 1..444 /ncRNA_class="lncRNA" /gene="LOC107337268" /product="uncharacterized LOC107337268" /db_xref="GeneID:107337268" ORIGIN // cagaatgggtgttcctcttgtggttttgcttgaattctgttctgagggtgataacgtcttgatgccgtcaatctcttcttgtctgctaatgagtggctcaaatttgttcccacgaaagaggtggaaaatccgttctttggacaaacaagtaattttgggattccagcatcttggtctttaatgtttggatcaccaatgcattggcatggaaacctattttagtgaggcagactcatgagttatgtacttaccataactttcacgtttgtttgatcactgttttgcgcttagtttagcaaggaacctctccatgttacgggtcattatttgtagtatttgctcaaaacgttaccatgaaacagctaccacgtgtcaaa...
position 69
XR_001562778.1 - Acropora digitifera - NCBI
PREDICTED: Belonocnema kinseyi uncharacterized LOC117172993 (LOC117172993), transcript variant X1, mRNA. (617 bp)
LOC117172993" /protein_id="XP_033217224.1" /db_xref="GeneID:117172993" /translation="MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG" ORIGIN // gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagagatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacagggggaggctatggagctcctgcatctactaccgcaactaaagccgcagctcccaaaaaggatgaggatatcattactacgatgaaacataaagtgacagaaagcactatgtacagacatgtacgccacc...
position 85
XM_033361333.1 - Belonocnema kinseyi - NCBI
Fusarium redolens Nitroreductase-like protein (BKA55DRAFT_527765), partial mRNA. (618 bp)
K., Riley,R., Lipzen,A., Henrissat,B., Kohler,A., Grigoriev,I.V., Martin,F.M. and Hacquard,S. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (05-APR-2021) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggccgctgaactctccgccaatctcttcttgcagttcgtcaagagccgacgaacctactaccccctctcaaagaaccttcccatctccacctctcgcatccaggagattgttaacgaggctgtcctgcatacccccacatcctttaactcccagtctaaccgtctggtcgtcctccacggcaccgagcatgagaagctgtgggacatcactattgacaccctgaagcctatcgtgcccgctgcgaactggacggtcactagtgataagctcgccttattcaagggcgccgctggtaccatcctcttcttcaatgatatcaccaccgtcgag...
position 21
XM_046188949.1 - Fusarium redolens - NCBI
PREDICTED: Arabidopsis lyrata subsp. lyrata ubiquitin-conjugating enzyme E2 36-like (LOC110230388), mRNA. (391 bp)
position 292
XM_021033133.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Aspergillus piperis CBS 112811 hypothetical protein (BO85DRAFT_383017), partial mRNA. (453 bp)
position 301
XM_025656494.1 - Aspergillus piperis CBS 112811 - NCBI
Brettanomyces bruxellensis uncharacterized protein (BRETT_000934), partial mRNA. (543 bp)
Research, Australian Wine Research Institute, Corner of Hartley Grove and Paratoo Road, Urrbrae, SA 5064, Australia atggttgcataccaatttagttccgtttgtgagaattgtgaactaaatgtgaacatgagtgactcagataaaacagacaagaaatttccacgctcttctctttccagaacaactacaacgactagcataactacccctgttcacccaatggaattggttgtacaatctcttcttgaatcacctcttgagcttctaaatttgagtattcattcattgtatgaatcgcaaatgattctcacaacaatattagatcgaatgcagcggaaacttgacaaatgtcttaggggcattggtaaaagtaggcaagaaccaattactactgacacagatacgcaaaatttacaatatccaaacgagcatcgaaatagggcaaactcagatgatgatctgacaacacagccaggaccagacaaaagcttgacaattgaagaatatgctgccagaattcatacgatcaagctccgcattgtaaaa...
position 163
XM_041279492.1 - Brettanomyces bruxellensis - NCBI
Caenorhabditis elegans Unclassified non-coding RNA ZK1193.9 (ZK1193.9), ncRNA. (133 bp)
AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA gaaggcgaccacgtcgtcgccaagaagagattgaagacgacgaatggagcgaaagtagtaaggaggggttgagggggggggaggtcgggatcgagatggcataatgtaggaaccggatggaagagtctaaaag
position 21
NR_070329.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Fukomys damarensis uncharacterized LOC104847975 (LOC104847975), ncRNA. (576 bp)
RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:104847975" ncRNA 1..576 /ncRNA_class="lncRNA" /gene="LOC104847975" /product="uncharacterized LOC104847975" /db_xref="GeneID:104847975" ORIGIN // ctggtgaatggaggctgacttcttgctctccaagaactgcaagtagctacccaatctcttcttgaaatcagcagtctgtgagctcactgtagtggggcagccagaaccttaaagcctaacaatgggacagtgacaagaagagaggtggagagaaactttcacagtccccctcttccactccaagagaagaaacacacggctttattatggtaccaagtccacctccagatagaagcaatacatctcctcttgaacaagactgtttctccagtttaagcaaatctatccaaactacctccaagctgcagtgaatcatacggtggctgaaggaactacactaagaaggacttgaaagactt...
position 52
XR_776269.2 - Fukomys damarensis (Damara mole-rat) - NCBI
Rhizoctonia solani Lytic polysaccharide mono-oxygenase, cellulose-degrading (RhiXN_09028), partial mRNA. (567 bp)
China Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China atgcgcttcctggctggtttattgactttggcgactttggcgtcgtccgttgtcgctcatggcattgtaactcaacctccaactcgcacactcgggagtgccatgattgcagcttgcggtgaaggtgctgtctcggctcaaaaatccaatgtcaagggaccgattgaaagccagattgccaagattgattccaactacaagcccgcgcaatgcaatctcttcttgtgccgtggccaacagtttgctgacaacaaggacaaagtccaaacctacaagactggtcaagtcgtgaacattgtactagacattgagaaccaccatcctgttggctatgcaaacgtatctgttatcgatactgccacaaacaagatggttggcaagcctctgattgcatgggatccttactttactggttatccgtaccctaaggatcaagagaacttcaacgtcactattccagagctcagcggcaaatgcaagactgccggagaatgtgttctacaataccactggtactcccgaacgg...
position 213
XM_043328844.1 - Rhizoctonia solani - NCBI
PREDICTED: Lingula anatina protein FAM84B-like (LOC106176727), mRNA. (474 bp)
position 321
XM_013559232.1 - Lingula anatina - NCBI
Meira miltonrushii Isochorismatase hydrolase (FA14DRAFT_152158), partial mRNA. (618 bp)
position 413
XM_025497511.1 - Meira miltonrushii - NCBI
PREDICTED: Herrania umbratica uncharacterized LOC110427542 (LOC110427542), mRNA. (417 bp)
misc_feature 144 /gene="LOC110427542" /note="gag-polypeptide of LTR copia-type; Region: Retrotran_gag_2; pfam14223" /db_xref="CDD:316719" ORIGIN // atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag
position 115
XM_021443097.1 - Herrania umbratica - NCBI
Phytophthora infestans T30-4 conserved hypothetical protein (PITG_18933) mRNA, complete cds. (669 bp)
position 449
XM_002996993.1 - Phytophthora infestans T30-4 - NCBI
PREDICTED: Raphanus sativus uncharacterized LOC108846357 (LOC108846357), mRNA. (504 bp)
CDS 123..434 /gene="LOC108846357" /codon_start=1 /product="uncharacterized protein LOC108846357" /protein_id="XP_018475092.1" /db_xref="GeneID:108846357" /translation="MDTMKIIKLHVILVSFLLIFEVPSILGFSMRGTTRSEPEAFHGREYFSAMKSRKLMVTNLQVDYSADYDDGASSSASPSPPVPDYDDDINKRQGDVPSPAIGH" ORIGIN // caacaccacaatctcttcttggatcctaaacataacaagaagaaagaacacagatacgaattctcttattttcaccatttaatttgattgttttcttgaataggtatatagagctactagaaatggatacaatgaagattattaaacttcacgttatactagtctctttcttactcatctttgaagttccttcgattcttgggttcagtatgagaggcactactagatcggagccggaagcatttcacggcagagagtacttctcggcgatgaagagcaggaagttgatggttacaaacttgcaagtcgattattca...
position 9
XM_018619590.1 - Raphanus sativus (radish) - NCBI
Caenorhabditis remanei hypothetical protein (CRE_18336) mRNA, partial cds. (2351 bp)
position 1624
XM_003089063.1 - Caenorhabditis remanei - NCBI
PREDICTED: Cucumis sativus ripening-related protein grip22 (LOC101211270), mRNA. (648 bp)
misc_feature 397..636 /gene="LOC101211270" /note="Rare lipoprotein A (RlpA)-like double-psi beta-barrel; Region: DPBB_1; cl04011" /db_xref="CDD:296184" ORIGIN // atggcaaaattggcttgcttggtctcttttttctttttggttctttctcttttgggcctttctcaagcaatctcttcttgcagggagccatgtcaaaccttgaaaaattgtaaaggtcaattgatttgtataaatggccaatgtaatgatgatcccgatgttggaactcgcatttgttcaaccgacagtgataacggagcagatggagaaaaatttcgttgtgaggcatttggaagattacattgcaaaggcaaatcgttcccccaattcaaatgctcgcctcgagtgacttcctcaactcgagctatcctaacaaataatgactttagtaaaggtggggatggaggagacccgtctgagtgtgatggaaagttccatcataactctcaaccaatagtggcattgtccacgggttggtacaacgggggatctagatgt...
position 68
XM_011658707.1 - Cucumis sativus (cucumber) - NCBI
PREDICTED: Theobroma cacao uncharacterized LOC108661919 (LOC108661919), mRNA. (507 bp)
position 481
XM_018120908.1 - Theobroma cacao (cacao) - NCBI
Aspergillus costaricaensis CBS 115574 hypothetical protein (BO79DRAFT_277183), partial mRNA. (511 bp)
Creek, CA 94598-1698, USA atggatttccgcaacctatcattcactctcctcctgctatccgctacagtcatgttatatttcaggactctactagcgcatcccatctacatgattagcacccctgcatcagtgcaaactccagactcagcgccaaccgacgccctcgccttcctcgacgagcccgtcttcagaccactggcatctcacatagcggacaacccatatccgtggcgtgataaacgtccattccaggagaccaattttgcgttactcatgggtgctgtccaatctcttcttgaggctgaggttgacgagggagagggtggtgtgagtttgaatgagagctatgggcaacaggatggcattgagagtaactcgtccgagacatattttctctgggctggggaagatgagaagtggtcttgcgcttagcaaaagcgctcagaggagttgagaaagtgaagatggtccttcgagacctgggattgtgagaagttcatttttggaaagtgggtttaaaacccactat
position 268
XM_025687799.1 - Aspergillus costaricaensis CBS 115574 - NCBI
PREDICTED: Gossypium hirsutum calcium load-activated calcium channel (LOC107891247), mRNA. (1188 bp)
misc_feature 420..899 /gene="LOC107891247" /note="Integral membrane protein DUF106; Region: DUF106; pfam01956" /db_xref="CDD:396507" ORIGIN // gggattataggaggtgtgtttttctgggaacatatctttggagttgaatgctaacaagaagagattgaagttagtctatttaagttgaatgctaacaagaagagattgaagttagtctatttaagtgaatgcttcaagttgaactccgcaaattgtgaaagaaagaggtttcttgagttcatccttttcatttgtaggttgtatcgtttaataatagagataagagatgggttgaaatgagtaagcccatagtggtgagaaataaaaggcaaagcccactccttgggttgtcgtctacttgggattcgaatcaatttgactaggaacggatcacagagactgagagtgaagacacccacccaatcaaccttgtgaaaatggcgacaccccaattcctatcatccttccagtactccgacagtctaacagtcgtagctatctccttttgcactgccat...
position 55
XM_016815976.2 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Syngnathus acus prefoldin 5 (pfdn5), mRNA. (612 bp)
position 566
XM_037252075.1 - Syngnathus acus (greater pipefish) - NCBI
PREDICTED: Dioscorea cayenensis subsp. rotundata uncharacterized LOC120275457 (LOC120275457), ncRNA. (148 bp)
samples with support for all annotated introns" /db_xref="GeneID:120275457" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC120275457" /product="uncharacterized LOC120275457" /db_xref="GeneID:120275457" ORIGIN // tgaaacccaaatcatgttttatgtttatggttgtagtaatgttcttcgtcatgtataagttgacaaaattccaacaggcacaagaagagattgaatcagtatctcagacttttgattccatgatgaggaggacaccaaagaagctgta
position 81
XR_005541109.1 - Dioscorea cayenensis subsp. rotundata (Guinea yam) - NCBI
Arabidopsis thaliana hypothetical protein (AT2G18970), mRNA. (531 bp)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA tccaatctcactcaaaatctcctccatgttcatctcttctccacctggcaaaagcttctgcaattccttcaatctcttcttgatctctcctccttcttcttcttcgtcgctgtcttggtgtttttctccaccttgtctcttgctcgatctttctagaatctcggaaggagaactactagtgctaattggatcatcataaggggaagataatagcttctgttgcaagaaacggctccacgcgaattcttgagcagacaatgcgaaagccatgtctacttcatgtttcacgggttcttgtttggttggagagaaaagactcgctttctcttgtttataatttgcctctccatgtgaaatttgtttgcttcgtcggaactct...
position 70
Synonym: F19F24.17; F19F24_17
NM_127454.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
[Candida] duobushaemulonis uncharacterized protein (CXQ87_002009), partial mRNA. (684 bp)
position 315
XM_025480531.1 - [Candida] duobushaemulonis - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC110938512 (LOC110938512), ncRNA. (219 bp)
ncRNA 1..219 /ncRNA_class="lncRNA" /gene="LOC110938512" /product="uncharacterized LOC110938512" /db_xref="GeneID:110938512" ORIGIN // ctcaagtacggcgtgcaacaagtgcctacccacgtcgtcaaagaactcatcatgcacgaggtggtgcttgggggtggccaggatgcatctgctgttaccacaaccatcatcgtgcggggaagtttgaagccaaattttatgacaaggttctgcaagaagagattggaggcgttaaaggacatttcgggccaattaatgctttggcattcaacccggatg
position 153
XR_002591448.2 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Pseudonaja textilis uncharacterized LOC113437314 (LOC113437314), ncRNA. (153 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:113437314" ncRNA 1..153 /ncRNA_class="lncRNA" /gene="LOC113437314" /product="uncharacterized LOC113437314" /db_xref="GeneID:113437314" ORIGIN // acaatcatccaatggaacagcttgccatcagaagctgtgagtacttcatcacttgagactttcaagaagagattggactgtcatttttcagaaatggtgtaggtctcctgcttgggcaggggtttggactagattacctacaaggtcttttcc
position 63
XR_003374214.1 - Pseudonaja textilis - NCBI
Microdochium trichocladiopsis uncharacterized protein (B0I36DRAFT_111575), mRNA. (734 bp)
CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (06-APR-2021) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA ccaggcagtctcatgcgggcgtgataacgtcaatgcagcagcagcaccacaccacaccagagtacagcttcacacacatggcgtgcatgattagattagcccaccgtcgtcgcactcaatcaatctcttcttgcccatgggggggttgcaaagcctccaggtccttaggcgcgatccttggctatagtgccaaaccttgatatggcaatcgtcacggggattgtggcagccgcgtgcgcgcaggcgacaatgctgaagcggcgcctcctggaacgctccgcggaaccttgggaagagtgctttgtccccaagccacgttccggcatgcgggcaaagtctcgcattaaatcctcgggcagcttggccaatggtgaagcgagcaacggactccccgttggccactgcgcagatgtcaaaacaacaaggg...
position 121
XM_046147897.1 - Microdochium trichocladiopsis - NCBI
PREDICTED: Belonocnema kinseyi uncharacterized LOC117172993 (LOC117172993), transcript variant X2, mRNA. (742 bp)
LOC117172993" /protein_id="XP_033217225.1" /db_xref="GeneID:117172993" /translation="MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG" ORIGIN // gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagaggagaaaaactggaacggtgtccactcttcggaattaagaaccgactgaaatggactaaaagaaaaagaataacagacacagacgacatgcgacgtgccggtttgaaaataagcacgtggtgactgatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacaggggg...
position 85
XM_033361334.1 - Belonocnema kinseyi - NCBI
Aspergillus eucalypticola CBS 122712 endo-1,4-beta-xylanase 3 (BO83DRAFT_446547), partial mRNA. (701 bp)
position 688
XM_025536602.1 - Aspergillus eucalypticola CBS 122712 - NCBI
Talaromyces proteolyticus putative mitochondrial 54S ribosomal protein YmL33 (BGW36DRAFT_379268), mRNA. (745 bp)
position 573
XM_046216190.1 - Talaromyces proteolyticus - NCBI
Aspergillus luchuensis uncharacterized protein (AKAW2_11553S), partial mRNA. (660 bp)
position 508
XM_041684050.1 - Aspergillus luchuensis - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : both:caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.083 | 0.083 | count_done;
0.136 | 0.052 | search_done;,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.143 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]