2024-05-17 19:12:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001342995 1018 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana E2F-associated phosphoprotein (AT5G08320), mRNA. ACCESSION NM_001342995 VERSION NM_001342995.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1018) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M., Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R., Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J., Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J., Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L., Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B., Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E., Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A., Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M., See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L., Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R., Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R., Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N., Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B., Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H., Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W., Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M., Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K., Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C., Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P. CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington University in St Louis Sequencing Consortium; European Union Arabidopsis Genome Sequencing Consortium TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 823-826 (2000) PUBMED 11130714 REFERENCE 2 (bases 1 to 1018) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1018) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1018) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003076). FEATURES Location/Qualifiers source 1..1018 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="5" /ecotype="Columbia" gene 1..1018 /locus_tag="AT5G08320" /gene_synonym="F8L15.50; F8L15_50" /db_xref="Araport:AT5G08320" /db_xref="GeneID:830728" /db_xref="TAIR:AT5G08320" CDS 117..440 /locus_tag="AT5G08320" /gene_synonym="F8L15.50; F8L15_50" /codon_start=1 /product="E2F-associated phosphoprotein" /protein_id="NP_001331548.1" /db_xref="GeneID:830728" /db_xref="Araport:AT5G08320" /db_xref="TAIR:AT5G08320" /translation="
MASPTNSQKTVSDDEEVDYSIKPEFYDSDIDDKDELWMDKKRDGRTSDALLSCPACFTTVCLECQRYFPLSTSELGVLSSYDCYIPSRLCFLNVARAPLFNPHQCVC"
misc_feature 192..>314 /locus_tag="AT5G08320" /gene_synonym="F8L15.50; F8L15_50" /note="E2F-associated phosphoprotein; Region: Eapp_C; pfam10238" /db_xref="CDD:431162" ORIGIN
atcgtcttcgtcggtgaacctccgatttgactgcaccgtcggagctcgacgctgagctaagcttaaccaagagctgtcgtatattacactagcagtgaagatcgaatcttaaaaccatggcttctccgaccaattcacagaaaacagtttcggatgacgaggaagttgattactccatcaaaccggagttctatgattcagatattgatgataaagatgagctttggatggataagaagagagatggtcgtacttctgatgctcttcttagctgtccagcttgtttcaccactgtctgcttagagtgtcagaggtattttcctctctcaacatcagaacttggtgttttatcttcatacgattgttatatcccatccaggctttgctttctcaatgttgctagggctccattgttcaatcctcaccaatgtgtttgctaatatattgatagtaacttgctagattctggaatgttgacttgattatgagattcttgacaattgttacaggctctaggtttttgttaggaatgacaatcttggtagaatccaaaccagttatatgacttgattaacgagaaaaatttctactctcagtccaattcccaatcccaaaacccataggcacgagcagtatgtgacacagtacagagcagtctttgtggtcaattgcaaagtaggtacagacacagttttgcaacagaatacaatgcccttaaaggttggtaaaagaaggagagattccgagatgcaagaaactggttctgaagatagcgaaaaagttaacccggtcttttgctcagcttgttccacagagatcggagtagttgacagtgaagagatctaccatttctttaatgtcattccaagcgagccttaaaacaacctggttttatgagttatttgtaacgagttctaaacaggtgattaggattaaagtttcgattgtttgcgttaatctttacgttgcatgtatatcgtttgataaaaatcaagtcactagagaattttgagttata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]