GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-12-06 06:21:31, GGRNA : RefSeq release 208 (Sep, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Arabidopsis thaliana root meristem growth factor (RGF5), mRNA. (549 bp)
." /codon_start=1 /product="root meristem growth factor" /protein_id="NP_001119414.1" /db_xref="GeneID:6241076" /db_xref="TAIR:AT5G51451" /db_xref="Araport:AT5G51451" /translation="MSSIHVASMILLLFLFLHHSDSRHLDNVHITASRFSLVKDQNVVSSSTSKEPVKVSRFVPGPLKHHHRRPPLLFADYPKPSTRPPRHN" ORIGIN // REFERENCE 1 (bases 1 to 549) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,...
AA_position 84
Synonym: CLE-like7; CLEL7; GLV10; GOLVEN 10; root meristem growth factor 5
NM_001125942.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana root meristem growth factor 1 (RGF1), mRNA. (575 bp)
." /codon_start=1 /product="root meristem growth factor 1" /protein_id="NP_001119468.1" /db_xref="GeneID:836202" /db_xref="TAIR:AT5G60810" /db_xref="Araport:AT5G60810" /translation="MYVNKFYHAYQNFYIAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTADYSNPGHHPPRHN" ORIGIN // REFERENCE 1 (bases 1 to 575) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C...
AA_position 97
Synonym: GLV11; GOLVEN 11; MAE1.14; MAE1_14; root meristem growth factor 1
NM_001125996.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana root meristem growth factor 1 (RGF1), mRNA. (442 bp)
." /codon_start=1 /product="root meristem growth factor 1" /protein_id="NP_200889.2" /db_xref="GeneID:836202" /db_xref="TAIR:AT5G60810" /db_xref="Araport:AT5G60810" /translation="MVSIRVICYLLVFSVLQVHAKVSNANFNSQAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTADYSNPGHHPPRHN" ORIGIN // REFERENCE 1 (bases 1 to 442) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C...
AA_position 112
Synonym: GLV11; GOLVEN 11; MAE1.14; MAE1_14; root meristem growth factor 1
NM_125474.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana proline-rich receptor-like kinase (AT1G13050), mRNA. (1476 bp)
." /codon_start=1 /product="proline-rich receptor-like kinase" /protein_id="NP_172764.1" /db_xref="Araport:AT1G13050" /db_xref="GeneID:837862" /db_xref="TAIR:AT1G13050" /translation="MSHHHYETNPHFVQFSLQDQHQGGPSSSWNSPHHHQIPQAHSVAPPRVKIKTRGRHQTEPPETIHESPSSRPLPLRPEEPLPPRHNPNSARPLQLSPEEQRPPHRGYGSEPTPWRRAPTRPAYQQGPKRTKPMTLPATICCAILLIVLILSGLILLLVYLANRPRSPYFDISAATLNTANLDMGYVLNGDLAVVVNFTNPSKKSSVDFSYVMFELYFYNTLIATEHIEPFIVPKGMSMFTSFHLVSSQVQIQMIQSQDLQLQLGTGPVLLNLRGTFHARSNLGSLMRYSYWLHTQCSISLNTPPAGTMRARRCNTKR" ORIGIN // REFERENCE 1 (bases 1 to 1476) AUTHORS Theologis,A., Ecker,J.R., Palm,...
AA_position 82
Synonym: F3F19.7; F3F19_7
NM_101175.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15), mRNA. (1612 bp)
RVVFKPGHRVNLRDGREEAAMVIFGAIDELLAATKINVKHIKILVLNCGVLNTTPSLSAMVINHYKLRHNTESYNLGGMGCSAGVIAIDLAKDLLNAHQGSYALVVSTEIVSFTWYSGNDVALLPPNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLVRTHKGMEDTSYKSIELREDRDGKQGLYVSRDVMEVGRHALKANIATLGRLEPSFEHICVLASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGDRVWQIGFGSGFKCNSVVWKALKNIDPPRHNNPWNL" ORIGIN // REFERENCE 1 (bases 1 to 1612) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M., Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B., Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De Simone,V., Choisne,N., Artiguenave,F., Robert,C...
AA_position 329
Synonym: 3-ketoacyl-CoA synthase 15
NM_001339560.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana RING/U-box superfamily protein (ATL43), mRNA. (1780 bp)
Plants - 4839; Viruses - 72; Other Eukaryotes - 1066 (source: NCBI BLink)." /codon_start=1 /product="RING/U-box superfamily protein" /protein_id="NP_196200.3" /db_xref="GeneID:830466" /db_xref="TAIR:AT5G05810" /db_xref="Araport:AT5G05810" /translation="MSSSSLILLFSTLSLFLNVSLADNHTAVVITTSDTPPPLPPPSPPPRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGGGYYNGGGVVGGRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELQFSKDESNSVNNNPPGLTRFIPVSRISGRHSSAGERASRLNEIRTSSSYKSNPMSFRRSLDSSLKVNDAGEEKSESVAVNCLDRLQRKDGLLLIPNRESFEGRFEHRIIISGGNRDDQRWSEVRPSDLLYLRSEMILSD...
AA_position 45
Synonym: MJJ3.23; MJJ3_23
NM_120663.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15), mRNA. (1530 bp)
RVVFKPGHRVNLRDGREEAAMVIFGAIDELLAATKINVKHIKILVLNCGVLNTTPSLSAMVINHYKLRHNTESYNLGGMGCSAGVIAIDLAKDLLNAHQGSYALVVSTEIVSFTWYSGNDVALLPPNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLVRTHKGMEDTSYKSIELREDRDGKQGLYVSRDVMEVGRHALKANIATLGRLEPSFEHICVLASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGDRVWQIGFGSGFKCNSVVWKALKNIDPPRHNNPWNL" misc_feature 114..1424 /gene="KCS15" /locus_tag="AT3G52160" /gene_synonym="3-ketoacyl-CoA synthase 15" /note="3-ketoacyl-CoA synthase; Region: PLN02192" /db_xref="CDD:215123" ORIGIN // REFERENCE 1 (bases 1 to 1530) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,...
AA_position 442
Synonym: 3-ketoacyl-CoA synthase 15
NM_115076.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/at/aa%3aPPRHN
lang : en | div : | spe : at | query_string : aa:PPRHN | format : html | download :

0.000 | 0.000 | search_start;
0.121 | 0.121 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(aa:PPRHN)?source=Arabidopsis thaliana (thale cress)?to=0&format=json
0.142 | 0.021 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(aa:PPRHN)?source=Arabidopsis thaliana (thale cress)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.143 | 0.001 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]