GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-01 17:35:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_179778                792 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana histone deacetylase-related / HD-like protein
            (HDT4), mRNA.
ACCESSION   NM_179778
VERSION     NM_179778.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 792)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 792)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 792)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 792)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
FEATURES             Location/Qualifiers
     source          1..792
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..792
                     /gene="HDT4"
                     /locus_tag="AT2G27840"
                     /gene_synonym="F15K20.6; F15K20_6; HD2D; HDA13; HDT04;
                     HISTONE DEACETYLASE; HISTONE DEACETYLASE 13; histone
                     deacetylase 2D"
                     /note="Belongs to the plant specific HD2 type proteins;
                     similar to nucleolar Zea mays histone deacetylase;
                     HD2-p39"
                     /db_xref="Araport:AT2G27840"
                     /db_xref="GeneID:817331"
                     /db_xref="TAIR:AT2G27840"
     CDS             68..613
                     /gene="HDT4"
                     /locus_tag="AT2G27840"
                     /gene_synonym="F15K20.6; F15K20_6; HD2D; HDA13; HDT04;
                     HISTONE DEACETYLASE; HISTONE DEACETYLASE 13; histone
                     deacetylase 2D"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL986417.1,INSD:ES018493.1,INSD:DR297197.1,
                     INSD:DR379173.1,INSD:DR373732.1,INSD:BP671651.1,
                     INSD:Z26451.1,INSD:AI999559.1,INSD:DR325152.1,
                     INSD:ES111786.1,INSD:ES131334.1,INSD:EH909696.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT008535.1,INSD:AF255713.1"
                     /note="HDT4; FUNCTIONS IN: histone deacetylase activity;
                     INVOLVED IN: production of siRNA involved in RNA
                     interference; LOCATED IN: nucleolus; EXPRESSED IN: 22
                     plant structures; EXPRESSED DURING: 13 growth stages; BEST
                     Arabidopsis thaliana protein match is: histone deacetylase
                     2B (TAIR:AT5G22650.2); Has 725 Blast hits to 661 proteins
                     in 171 species: Archae - 0; Bacteria - 166; Metazoa - 184;
                     Fungi - 55; Plants - 136; Viruses - 17; Other Eukaryotes -
                     167 (source: NCBI BLink)."
                     /codon_start=1
                     /product="histone deacetylase-related / HD-like protein"
                     /protein_id="NP_850109.1"
                     /db_xref="Araport:AT2G27840"
                     /db_xref="GeneID:817331"
                     /db_xref="TAIR:AT2G27840"
                     /translation="
MVHASQVTLGDVEKVKKDETFAVYVKIGDDENGFMIGNLSQKFPQFSIDLYLGHEFEISHNSTSSVYLIGYRTFDAFDELDEEIDSDSELDEYMEQQIAALPQNEINPEEDDESDSDEMGLDEDDDSSDEEDVEAEAPLKVAPPSKKMPNGAFEIAKGGKKNKSSGGKKRCPFPCGPSCKK"
     misc_feature    <71..280
                     /gene="HDT4"
                     /locus_tag="AT2G27840"
                     /gene_synonym="F15K20.6; F15K20_6; HD2D; HDA13; HDT04;
                     HISTONE DEACETYLASE; HISTONE DEACETYLASE 13; histone
                     deacetylase 2D"
                     /note="Nucleoplasmin-like domain; Region: NPL; pfam17800"
                     /db_xref="CDD:436054"
ORIGIN      
atgttcaattttaggtatcgagattaagccagggaagccatttaaggtgatacaaaaagatggattcatggtccatgcctctcaggttacccttggtgacgttgagaaggttaaaaaagatgagacttttgccgtttatgtgaagattggtgatgatgagaatgggtttatgattggaaatctctcacagaagtttcctcaattttctattgatctctacttagggcacgagtttgagatttctcacaacagtacaagcagtgtctatcttattggttacaggacctttgatgcttttgacgaactggatgaggagattgattctgattctgagttagatgaatatatggaacaacaaattgctgctttgcctcaaaatgagatcaatcctgaagaagatgatgaatccgactcagatgagatgggtttggacgaggatgatgactcttcagatgaagaagatgtagaggctgaagcacctttaaaggtggctcctccgagcaaaaagatgccaaatggtgcatttgagatagctaaaggtggaaagaagaacaagtcatcaggagggaagaagagatgcccattcccttgtggtccctcttgcaaaaagtagaagatatttgcacaccaagtcacatttttccaatagaaatttttacttgactgtattggtgaatcgttgagtgacttatgaggcttttggcatcttaaaatttttggattattataatatatgttatgttgtcattttggagtgttaatgggtttaaatgaaatatgatttttgctctt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]