2024-05-03 09:45:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_126003 1706 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana ankyrin repeat protein (AKRP), mRNA. ACCESSION NM_126003 VERSION NM_126003.3 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1706) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M., Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R., Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J., Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J., Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L., Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B., Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E., Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A., Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M., See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L., Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R., Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R., Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N., Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B., Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H., Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W., Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M., Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K., Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C., Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P. CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington University in St Louis Sequencing Consortium; European Union Arabidopsis Genome Sequencing Consortium TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 823-826 (2000) PUBMED 11130714 REFERENCE 2 (bases 1 to 1706) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1706) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1706) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003076). On Sep 12, 2016 this sequence version replaced NM_126003.2. FEATURES Location/Qualifiers source 1..1706 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="5" /ecotype="Columbia" gene 1..1706 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="A locus involved in embryogenesis. Mutations in this locus result in embryo lethality." /db_xref="Araport:AT5G66055" /db_xref="GeneID:836737" /db_xref="TAIR:AT5G66055" CDS 130..1437 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /inference="Similar to RNA sequence, EST:INSD:EH874977.1,INSD:EL238002.1,INSD:AV826046.1, INSD:EL153848.1,INSD:BP634792.1,INSD:DR276603.1, INSD:EL320287.1,INSD:AV441775.1,INSD:DR276607.1, INSD:T88492.1,INSD:AV795108.1,INSD:AV521462.1, INSD:BP778786.1,INSD:AV548212.1,INSD:EL002765.1, INSD:AA728437.1,INSD:AU229495.1,INSD:AV793530.1, INSD:DR276601.1,INSD:EH918049.1,INSD:EL189874.1, INSD:AV566793.1,INSD:DR276606.1,INSD:EH943378.1, INSD:DR276604.1,INSD:EH968745.1,INSD:BP588906.1, INSD:EL220280.1,INSD:AU238327.1,INSD:EL163346.1, INSD:AW004311.1,INSD:EL248447.1,INSD:EH881256.1, INSD:AV793392.1,INSD:EL219938.1,INSD:BP625280.1, INSD:EL040089.1,INSD:EL032112.1,INSD:DR276605.1, INSD:AV562673.1,INSD:EL017849.1,INSD:EL995044.1, INSD:BP593812.1,INSD:EG439307.1,INSD:BP561270.1, INSD:DR276602.1" /inference="similar to RNA sequence, mRNA:INSD:AY052363.1,INSD:AK117484.1,INSD:BT001055.1, INSD:BX833252.1,INSD:BX829867.1" /note="ankyrin repeat protein (AKRP); INVOLVED IN: embryo development ending in seed dormancy; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Ankyrin repeat-containing domain (InterPro:IPR020683), Ankyrin repeat (InterPro:IPR002110); BEST Arabidopsis thaliana protein match is: Ankyrin repeat family protein (TAIR:AT5G40160.1); Has 83523 Blast hits to 28077 proteins in 1268 species: Archae - 145; Bacteria - 7202; Metazoa - 43238; Fungi - 6726; Plants - 3393; Viruses - 1185; Other Eukaryotes - 21634 (source: NCBI BLink)." /codon_start=1 /product="ankyrin repeat protein" /protein_id="NP_569027.2" /db_xref="GeneID:836737" /db_xref="TAIR:AT5G66055" /db_xref="Araport:AT5G66055" /translation="
MQSLSTPHTISLLLPRTSPSRLSPSLHSLAFPTRLRSLSYSSQTSILPDAGDDFIVGDCLVYEDGVFEDPYLDKEVTQVAKQERKKNRRGGAKRLDESEIEPENLVPEEWRDIQAEVNLTKKDKRKIAQEMEFGVRVEKKRQGLIPLRKVDLNDFLTYKEAKLAQLRPVILDKPGNFSDDSGASSDGETAVSSPSERVAPKNPRWAVYGKGFDHVAKFFNSDKYDPSDKKSDGPRKLLSKEEKFMLNSRNPDLAVATSKKWLPLHTLAACGEFYLVDSLLKHNLDINATDVGGLTVLHRAIIGKKQAITNYLLRESANPFVLDDEGATLMHYAVQTASAPTIKLLLLYNADINAQDRDGWTPLHVAVQARRSDIVKLLLIKGADIEVKNKDGLTPLGLCLYLGREIRTYEVMKLLKEFPLSRHKKRLVTTDEDIE"
misc_feature <697..>1365 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="ankyrin repeat protein; Provisional; Region: PHA02876" /db_xref="CDD:165207" misc_feature 910..999 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 1006..1098 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature order(1009..1011,1021..1026,1033..1041,1045..1050, 1060..1062,1069..1071,1096..1098,1102..1104,1108..1110, 1120..1125,1132..1140,1144..1149,1159..1161,1168..1170, 1195..1197,1201..1203,1207..1209,1219..1224,1231..1239, 1243..1248,1258..1260,1267..1269,1294..1296) /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:293786" misc_feature 1018..1296 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="Ankyrin repeats (3 copies); Region: Ank_2; pfam12796" /db_xref="CDD:432791" misc_feature 1102..1197 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 1201..1296 /gene="AKRP" /locus_tag="AT5G66055" /gene_synonym="ankyrin repeat protein; EMB16; EMB2036; EMBRYO DEFECTIVE 16; EMBRYO DEFECTIVE 2036" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" ORIGIN
cgggaagtcaggcccatatgtttaagtaaggcccattagaaagtgaggcccattgaaattgtcggatactacatcagaggccggcgaggaggagaggagaaagctccgttattcaagattattccgataatgcagtcactctccaccccacacaccatctctcttcttctccccagaacctctccgtctcgtctttctccctctcttcactcccttgctttccccactcgattacggtctctttcctattcttctcaaacgtcgatcctccccgatgccggcgatgatttcattgtcggtgactgtctcgtctacgaggacggcgtcttcgaagacccttaccttgataaggaggtcactcaggttgcgaagcaggagcgcaagaagaatcggcgtggcggggctaagagattagatgaatccgagattgagcccgagaacctcgtgccagaggaatggagggatattcaggcggaggtgaatctgacgaagaaggacaagcgcaaaatagcgcaggagatggagttcggggttcgggtggagaagaagaggcaagggctaattccgctgaggaaagttgacttgaatgactttctcacgtacaaggaagccaagttggctcaattgaggcctgtcattctcgataaaccgggaaatttctccgacgacagtggagcgtcaagcgatggagagaccgctgtatcatctcccagcgagcgagtggctcctaagaaccctagatgggcagtttacggaaagggattcgaccacgttgccaagttcttcaatagcgacaagtacgatcccagcgacaagaaatccgacggccctcgaaagctgctttcaaaagaagagaagtttatgctcaatagccggaatcctgacctagccgttgccacatcaaaaaaatggcttcctcttcacacactggcagcatgtggagagttttatctggttgattccttgctaaagcacaatcttgatatcaatgcaaccgatgtgggcggcttgacagtacttcaccgagcaatcattggtaagaagcaggctattactaactacctgctgagggaatcggcaaatccatttgttcttgatgacgaaggtgcgaccttgatgcactatgctgtgcaaacagcatcagctcccacaataaaacttctcctactgtataacgctgatataaacgctcaggacagggacgggtggactccactgcacgttgcagtacaggccagaagaagcgacattgtaaagcttcttttgataaaaggggcggacatagaagtgaagaacaaggatgggttaactccgcttgggctttgcctctaccttggaagagagataaggacgtatgaggtgatgaagctgttgaaagagtttccacttagcagacacaagaagagattggtaacaacagatgaagatattgaatagtcctttcaatttcagcttgaagtacactcacttatgagaacctgagaaaaggagatggaggtaaaggtgatgattagggcattggaacctcggagtcggagtgggtccactgtctcacttccttaaatttggtttgctgttagtcttatccatcgattttggatatttatcacaacttgatccattcttaaagaaaatatctgaaaataaataaaaagtaatacatatatatatatatatatattatttataacagtctgtgaatggat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]