LOCUS       NM_125441                965 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana homeobox protein 26 (HB26), mRNA.
ACCESSION   NM_125441
VERSION     NM_125441.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 965)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 965)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 965)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 965)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_125441.1.
FEATURES             Location/Qualifiers
     source          1..965
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..965
                     /gene="HB26"
                     /locus_tag="AT5G60480"
                     /gene_synonym="AtHB26; homeobox protein 26; MUF9.11;
                     MUF9_11; ZHD12; ZINC FINGER HOMEODOMAIN 12"
                     /db_xref="Araport:AT5G60480"
                     /db_xref="GeneID:836169"
                     /db_xref="TAIR:AT5G60480"
     CDS             128..799
                     /gene="HB26"
                     /locus_tag="AT5G60480"
                     /gene_synonym="AtHB26; homeobox protein 26; MUF9.11;
                     MUF9_11; ZHD12; ZINC FINGER HOMEODOMAIN 12"
                     /note="homeobox protein 26 (HB26); FUNCTIONS IN: DNA
                     binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription;
                     EXPRESSED IN: flower; CONTAINS InterPro DOMAIN/s: Homeobox
                     domain, ZF-HD class (InterPro:IPR006455), ZF-HD homeobox
                     protein, Cys/His-rich dimerisation domain
                     (InterPro:IPR006456), Homeodomain-related
                     (InterPro:IPR012287); BEST Arabidopsis thaliana protein
                     match is: zinc finger homeodomain 1 (TAIR:AT1G69600.1);
                     Has 1807 Blast hits to 1807 proteins in 277 species:
                     Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347;
                     Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="homeobox protein 26"
                     /protein_id="NP_200856.2"
                     /db_xref="GeneID:836169"
                     /db_xref="TAIR:AT5G60480"
                     /db_xref="Araport:AT5G60480"
                     /translation="

MSSLSKPNRQFLSPTTNNQDTGREQTIACARDMVVLYNECLKNHAVSLGGHALDGCGEFTPKSTTILTDPPSLRCDACGCHRNFHRRSPSDGFSQHRSPPSPLQLQPLAPVPNLLLSLSSGFFGPSDQEVKNKFTVERDVRKTAMIKKHKRTKFTAEQKVKMRGFAERAGWKINGWDEKWVREFCSEVGIERKVLKVWIHNNKYFNNGRSRDTTSSMSLNLKL"

     misc_feature    227..394
                     /gene="HB26"
                     /locus_tag="AT5G60480"
                     /gene_synonym="AtHB26; homeobox protein 26; MUF9.11;
                     MUF9_11; ZHD12; ZINC FINGER HOMEODOMAIN 12"
                     /note="ZF-HD protein dimerization region; Region:
                     ZF-HD_dimer; pfam04770"
                     /db_xref="CDD:398439"
     misc_feature    566..739
                     /gene="HB26"
                     /locus_tag="AT5G60480"
                     /gene_synonym="AtHB26; homeobox protein 26; MUF9.11;
                     MUF9_11; ZHD12; ZINC FINGER HOMEODOMAIN 12"
                     /note="homeobox domain, ZF-HD class; Region: homeo_ZF_HD;
                     TIGR01565"
                     /db_xref="CDD:130628"
ORIGIN      

taatccaaattgcaatcaacaatgttatttatataaacctattggacaaaatctctccctttatgtcattgacaacatttccagaaacagagtataaacgcactagtgagtgaaataagaatcagacatgagctcgttatcaaaaccaaacagacaatttttgtcaccaacaacaaacaaccaagacaccggcagagaacaaacaatcgcctgcgcccgagatatggttgtcttgtacaacgagtgccttaaaaaccacgcggtcagtctcggaggccacgctcttgacggctgcggtgagttcacaccaaagtcaaccaccatcctcacggaccctccgtcccttaggtgcgatgcttgtggctgccatcgcaacttccaccgtcgtagtccttctgacggcttcagtcagcaccggtcaccaccgtctccgttacagctgcagccactcgcccctgttccgaacttgcttctctctcttagctccggtttctttggaccctcggatcaagaagtcaagaacaaatttacggtggaaagggatgttaggaagactgcgatgattaagaaacataagaggacgaaattcacggcggagcagaaggtgaagatgagaggtttcgcggagagagcggggtggaagattaacggctgggatgagaagtgggtgagagagttttgtagtgaagttggaatagagagaaaagttcttaaggtttggatccacaacaataagtactttaacaacgggaggagcagagacacgacgtcctctatgtctttgaatttgaagttgtagatctctttacagtgatgggtcttcatcttcttgagataaggaaaaaccgaaacaaaaagaggttacggtagtctctgatccgaccggaatgtcacgtcagaaatataaattatctaagtttttttaaaattaaaaattattatcctagaagacttgtcattttggg

//