2024-05-02 08:03:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_115864 688 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana SKP1-like 13 (SK13), mRNA. ACCESSION NM_115864 VERSION NM_115864.2 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 688) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M., Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B., Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P., Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V., Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S., Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P., Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S., Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H., Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M., Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A., Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C., Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P., Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M., Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S., Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L., Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A., Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B., Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J., Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X., Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M., Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S., Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M. and Tabata,S. CONSRTM European Union Chromosome 3 Arabidopsis Sequencing Consortium; Institute for Genomic Research; Kazusa DNA Research Institute TITLE Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 820-822 (2000) PUBMED 11130713 REFERENCE 2 (bases 1 to 688) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 688) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 688) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003074). On Sep 12, 2016 this sequence version replaced NM_115864.1. FEATURES Location/Qualifiers source 1..688 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="3" /ecotype="Columbia" gene 1..688 /gene="SK13" /locus_tag="AT3G60010" /gene_synonym="ASK13; SKP1-like 13; T2O9.1" /db_xref="Araport:AT3G60010" /db_xref="GeneID:825171" /db_xref="TAIR:AT3G60010" CDS 44..508 /gene="SK13" /locus_tag="AT3G60010" /gene_synonym="ASK13; SKP1-like 13; T2O9.1" /note="SKP1-like 13 (SK13); FUNCTIONS IN: ubiquitin-protein ligase activity, protein binding; INVOLVED IN: ubiquitin-dependent protein catabolic process; LOCATED IN: endomembrane system; EXPRESSED IN: 15 plant structures; EXPRESSED DURING: M germinated pollen stage, 4 anthesis, seedling growth, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: E3 ubiquitin ligase, SCF complex, Skp subunit (InterPro:IPR016897), SKP1 component, dimerisation (InterPro:IPR016072), SKP1 component (InterPro:IPR001232), BTB/POZ fold (InterPro:IPR011333), SKP1 component, POZ (InterPro:IPR016073); BEST Arabidopsis thaliana protein match is: SKP1-like 11 (TAIR:AT4G34210.1); Has 1418 Blast hits to 1414 proteins in 268 species: Archae - 0; Bacteria - 0; Metazoa - 525; Fungi - 176; Plants - 537; Viruses - 11; Other Eukaryotes - 169 (source: NCBI BLink)." /codon_start=1 /product="SKP1-like 13" /protein_id="NP_567090.1" /db_xref="GeneID:825171" /db_xref="TAIR:AT3G60010" /db_xref="Araport:AT3G60010" /translation="
MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE"
misc_feature 53..400 /gene="SK13" /locus_tag="AT3G60010" /gene_synonym="ASK13; SKP1-like 13; T2O9.1" /note="BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in S-phase kinase-associated protein 1 (SKP1) and similar proteins; Region: BTB_POZ_SKP1; cd18322" /db_xref="CDD:349631" misc_feature order(119..124,134..136,146..148,158..163,167..169, 173..178,332..334,341..346,350..352) /gene="SK13" /locus_tag="AT3G60010" /gene_synonym="ASK13; SKP1-like 13; T2O9.1" /note="cullin binding site [polypeptide binding]; other site" /db_xref="CDD:349631" misc_feature order(302..304,320..322,332..334,341..343,356..358, 368..370,377..382,386..391,398..400) /gene="SK13" /locus_tag="AT3G60010" /gene_synonym="ASK13; SKP1-like 13; T2O9.1" /note="F-box protein binding site [polypeptide binding]; other site" /db_xref="CDD:349631" misc_feature 356..499 /gene="SK13" /locus_tag="AT3G60010" /gene_synonym="ASK13; SKP1-like 13; T2O9.1" /note="Skp1 family, dimerization domain; Region: Skp1; pfam01466" /db_xref="CDD:426275" ORIGIN
gtaaacaaaaatcgccaccacaaaaagaaaaaagaaggaaacgatgtcgaagatggttatgttgctgagctccgatggtgaatctttccaggtcgaagaagcagtcgcggtccagtcacagacgatagcacatatgattgaagacgattgcgtcgccaatggagtccctatcgcaaacgttacaggagtcatcctctcgaaggtgatcgagtattgcaagaaacacgtcgtttctgattcaccaaccgaagagagcaaagacgaactcaagaagtgggacgctgagttcatgaaggccctggaacagtcgtcgactctctttgatgttatgctggctgcgaattacctaaacataaaagacctgcttgaccttggttgccaaactgttgctgacatgatcactggcaagaaaccagacgagattcgtgcacttcttggcatcgagaacgattttacaccggaggaggaagaggagattcgtaaggagaatcaatgggcttttgaatgattctttagttttctttttcgacgttagtgtgctttctgatcttctttatcaagatcaatgtctcgtgttcttttttctttagtttgtttccgatctcttgaacagtgtcttttgttctttcttctcttgtgtgtatgtgtgttttcttgatcaatgtgacttcgttattgtcttttctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]