LOCUS       XM_747512                174 bp    mRNA    linear   PLN 18-APR-2022
DEFINITION  Aspergillus fumigatus Af293 uncharacterized protein (AFUA_1G12360),
            partial mRNA.
ACCESSION   XM_747512
VERSION     XM_747512.1
DBLINK      BioProject: PRJNA14003
            BioSample: SAMN00115746
KEYWORDS    RefSeq.
SOURCE      Aspergillus fumigatus Af293
  ORGANISM  Aspergillus fumigatus Af293
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus; Aspergillus subgen. Fumigati.
REFERENCE   1  (bases 1 to 174)
  AUTHORS   Nierman,W.C., Pain,A., Anderson,M.J., Wortman,J.R., Kim,H.S.,
            Arroyo,J., Berriman,M., Abe,K., Archer,D.B., Bermejo,C.,
            Bennett,J., Bowyer,P., Chen,D., Collins,M., Coulsen,R., Davies,R.,
            Dyer,P.S., Farman,M., Fedorova,N., Fedorova,N., Feldblyum,T.V.,
            Fischer,R., Fosker,N., Fraser,A., Garcia,J.L., Garcia,M.J.,
            Goble,A., Goldman,G.H., Gomi,K., Griffith-Jones,S., Gwilliam,R.,
            Haas,B., Haas,H., Harris,D., Horiuchi,H., Huang,J., Humphray,S.,
            Jimenez,J., Keller,N., Khouri,H., Kitamoto,K., Kobayashi,T.,
            Konzack,S., Kulkarni,R., Kumagai,T., Lafon,A., Latge,J.P., Li,W.,
            Lord,A., Lu,C., Majoros,W.H., May,G.S., Miller,B.L., Mohamoud,Y.,
            Molina,M., Monod,M., Mouyna,I., Mulligan,S., Murphy,L., O'Neil,S.,
            Paulsen,I., Penalva,M.A., Pertea,M., Price,C., Pritchard,B.L.,
            Quail,M.A., Rabbinowitsch,E., Rawlins,N., Rajandream,M.A.,
            Reichard,U., Renauld,H., Robson,G.D., Rodriguez de Cordoba,S.,
            Rodriguez-Pena,J.M., Ronning,C.M., Rutter,S., Salzberg,S.L.,
            Sanchez,M., Sanchez-Ferrero,J.C., Saunders,D., Seeger,K.,
            Squares,R., Squares,S., Takeuchi,M., Tekaia,F., Turner,G., Vazquez
            de Aldana,C.R., Weidman,J., White,O., Woodward,J., Yu,J.H.,
            Fraser,C., Galagan,J.E., Asai,K., Machida,M., Hall,N., Barrell,B.
            and Denning,D.W.
  TITLE     Genomic sequence of the pathogenic and allergenic filamentous
            fungus Aspergillus fumigatus
  JOURNAL   Nature 438 (7071), 1151-1156 (2005)
   PUBMED   16372009
  REMARK    Erratum:[Nature. 2006 Jan 26;439(7075):502. Lafton, Anne [corrected
            to Lafon, Anne]]
REFERENCE   2  (bases 1 to 174)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 174)
  AUTHORS   Nierman,W., Wortman,J., Pain,A., Anderson,M.J., Arroya,J., Hall,N.,
            Barrell,B., Fraser,C. and Denning,D.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2005) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_007194).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..174
                     /organism="Aspergillus fumigatus Af293"
                     /mol_type="mRNA"
                     /strain="Af293"
                     /db_xref="taxon:330879"
                     /chromosome="1"
     gene            <1..>174
                     /locus_tag="AFUA_1G12360"
                     /old_locus_tag="Afu1g12360"
                     /db_xref="GeneID:3510533"
     CDS             1..174
                     /locus_tag="AFUA_1G12360"
                     /old_locus_tag="Afu1g12360"
                     /note="encoded by transcript AFUA_1G12360A"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_752605.1"
                     /db_xref="GeneID:3510533"
                     /translation="

MPPDIFTYHRHTKQRLGPGLSLGNLAFRGLDGVCDSHIRNFVSIERTLNHGFVISFV"

ORIGIN      

atgccgcctgacatatttacctaccatcggcataccaagcagcgtttgggccctggtctgtcccttggtaatctagcattccgcggcctcgatggagtatgcgacagccacatcagaaatttcgtatccatagagaggaccttgaaccatgggtttgtcatctcatttgtctaa

//