LOCUS       XM_644371                234 bp    mRNA    linear   INV 25-OCT-2017
DEFINITION  Entamoeba histolytica HM-1:IMSS ubiquitin-like, putative
            (EHI_103510), partial mRNA.
ACCESSION   XM_644371
VERSION     XM_644371.1
DBLINK      BioProject: PRJNA19739
            BioSample: SAMN02953605
KEYWORDS    RefSeq.
SOURCE      Entamoeba histolytica HM-1:IMSS
  ORGANISM  Entamoeba histolytica HM-1:IMSS
            Eukaryota; Amoebozoa; Evosea; Archamoebae; Mastigamoebida;
            Entamoebidae; Entamoeba.
REFERENCE   1  (bases 1 to 234)
  AUTHORS   Loftus,B., Anderson,I., Davies,R., Alsmark,U.C., Samuelson,J.,
            Amedeo,P., Roncaglia,P., Berriman,M., Hirt,R.P., Mann,B.J.,
            Nozaki,T., Suh,B., Pop,M., Duchene,M., Ackers,J., Tannich,E.,
            Leippe,M., Hofer,M., Bruchhaus,I., Willhoeft,U., Bhattacharya,A.,
            Chillingworth,T., Churcher,C., Hance,Z., Harris,B., Harris,D.,
            Jagels,K., Moule,S., Mungall,K., Ormond,D., Squares,R.,
            Whitehead,S., Quail,M.A., Rabbinowitsch,E., Norbertczak,H.,
            Price,C., Wang,Z., Guillen,N., Gilchrist,C., Stroup,S.E.,
            Bhattacharya,S., Lohia,A., Foster,P.G., Sicheritz-Ponten,T.,
            Weber,C., Singh,U., Mukherjee,C., El-Sayed,N.M., Petri,W.A. Jr.,
            Clark,C.G., Embley,T.M., Barrell,B., Fraser,C.M. and Hall,N.
  TITLE     The genome of the protist parasite Entamoeba histolytica
  JOURNAL   Nature 433 (7028), 865-868 (2005)
   PUBMED   15729342
REFERENCE   2  (bases 1 to 234)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 234)
  AUTHORS   Lorenzi,H., Amedeo,P., Inman,J., Schobel,S. and Caler,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAR-2007) The Institute for Genomic Research, 9712
            Medical Center Drive, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_001914873).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..234
                     /organism="Entamoeba histolytica HM-1:IMSS"
                     /mol_type="mRNA"
                     /strain="HM-1:IMSS"
                     /db_xref="taxon:294381"
                     /chromosome="Unknown"
     gene            <1..>234
                     /locus_tag="EHI_103510"
                     /old_locus_tag="300.t00010"
                     /db_xref="GeneID:3403759"
                     /db_xref="Pathema:EHI_103510"
     CDS             1..234
                     /locus_tag="EHI_103510"
                     /old_locus_tag="300.t00010"
                     /note="encoded by transcript EHI_103510A"
                     /codon_start=1
                     /product="ubiquitin-like, putative"
                     /protein_id="XP_649463.1"
                     /db_xref="GeneID:3403759"
                     /db_xref="Pathema:EHI_103510"
                     /translation="

MLINIKLLNGRILSIDLEPTDKISDLKAKLEEIEGITPEQQRLVFGGRQLGDDKTLQELNIQPGTQINLLLALRGGF"

     misc_feature    7..228
                     /locus_tag="EHI_103510"
                     /old_locus_tag="300.t00010"
                     /note="first ubiquitin-like (Ubl) domain located at the
                     N-terminus of coronavirus SARS-CoV non-structural protein
                     3 (Nsp3) and related proteins; Region:
                     Ubl1_cv_Nsp3_N-like; cl28922"
                     /db_xref="CDD:452900"
ORIGIN      

atgttaattaacattaaacttcttaatggaagaattctttctattgaccttgaaccaacagataaaatctctgaccttaaagctaaattagaagaaattgaaggtattactccagaacaacaacgacttgtttttggtggaagacaacttggagatgataaaacacttcaagaacttaacattcaaccaggaactcaaattaatcttcttcttgctttaagaggaggtttttaa

//