ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-01 04:34:16, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_077329069 2052 bp mRNA linear VRT 27-SEP-2025
DEFINITION PREDICTED: Paroedura picta copper chaperone for superoxide
dismutase (CCS), transcript variant X1, mRNA.
ACCESSION XM_077329069
VERSION XM_077329069.1
DBLINK BioProject: PRJNA1334391
KEYWORDS RefSeq.
SOURCE Paroedura picta
ORGANISM Paroedura picta
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae;
Paroedura.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_135369) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_049243985.1-RS_2025_09
Annotation Pipeline :: NCBI Eukaryotic Genome Annotation
Pipeline (EGAP)
Annotation Software Version :: 10.5
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 09/25/2025
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..2052
/organism="Paroedura picta"
/mol_type="mRNA"
/isolate="Pp20150507F"
/db_xref="taxon:143630"
/chromosome="1"
/sex="female"
/tissue_type="blood"
/collection_date="2019-05-08"
gene 1..2052
/gene="CCS"
/note="copper chaperone for superoxide dismutase; Derived
by automated computational analysis using gene prediction
method: Gnomon. Supporting evidence includes similarity
to: 13 Proteins, and 100% coverage of the annotated
genomic feature by RNAseq alignments, including 16 samples
with support for all annotated introns"
/db_xref="GeneID:143833356"
CDS 88..903
/gene="CCS"
/codon_start=1
/product="copper chaperone for superoxide dismutase
isoform X1"
/protein_id="XP_077185184.1"
/db_xref="GeneID:143833356"
/translation="
MEAASGGAGGVRCRLEFAVQMTCQSCVEAVQAALQEVPGIQLLDVNLDSQSVLLETSLQTEKVHSLLESTGRKAVLKGMGGTMPQPFGSAAVAIISGPGSVQGVVRFLQMSQEKCLIDGTVDGLEPGSHGLHVHEFGDITSSCDSCGDHFNPDGNCHGGPQDLYRHAGDLGNILAADDGRASFRMEDSQLKVYDIIGRSLVVDAGEDDLGRGRHPLSKVTGNSGERVACGIIARSAGLFQNPKRVCTCDGVTLWEEQEKLGRKAASQPAHL"
misc_feature 130..852
/gene="CCS"
/note="copper, zinc superoxide dismutase; Region:
PLN02957"
/db_xref="CDD:215516"
polyA_site 2052
/gene="CCS"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
ggatttccgatctcttgatgttgtgtgtcctgttgaaaggagtccgggcggggaacgtttctcattaggaaaggaaggtgctacgaaatggaggcggcttctggaggggctggcggtgtcaggtgtcggctggagtttgctgtccagatgacctgtcagagttgtgtggaggcagtgcaggcagctcttcaagaagtaccaggcatccagctgcttgatgtcaatctagattcccaaagtgtgctgctagagaccagcctccaaacagagaaagtccacagccttttggaaagcactggacgcaaggctgtgctaaaaggaatgggaggcactatgccacagccatttggcagcgcagcagtggctataatatcaggccctggatcagtgcagggtgtggtgaggttcttgcagatgtcccaagagaaatgtctcattgatggcaccgtggatggtttggagccaggctcacatggcctgcacgttcacgaatttggggacatcaccagttcctgtgacagctgtggggaccacttcaaccctgatgggaactgccatgggggcccacaggacctgtacaggcatgctggggatcttgggaatatcctggctgctgatgatggaagggcttcttttcggatggaagacagccagttgaaggtctatgacatcattgggcgttccttggtggtagatgcaggagaggatgacttgggacgtggcaggcacccactctcaaaagttacgggcaattcaggcgagagagtggcctgtggaatcattgctcgctctgctggcctcttccagaaccccaagagagtatgtacctgcgatggagtgacactgtgggaagaacaagaaaaattgggcaggaaggcagctagccagccagctcatctttaagatatctggctgaccctgcaccacctctgctgcagatttatcggtctgtttggcataagactctttagggcacttgtgctgaaggggtgtgcttgtggccggttgcaacaaggccagtcaggcctagtcaccttgatacctatgcctagcagtgacataagtggggtgggcatattgctttcacaagtggcaatgattgggcagccactcagcgtatggccctgcaaactctactctgtatagaaacattccaagaaaagcattgactctctggatggaggcttctgcatgcacattgtttccccactctggttgcgtggccatcttttcctaatcctcccactttttcctggtctcttacggggttgattgtagcaaacagcaataaattaggtgcagctacatggatgcacagtaaaggcaaaaacttagcctgttgtatagctgctggttatttgaattaaaagctttgtggcctagctggggaggaggcgacatcttggaaaggtgtaagtggcccttgctgtgaaggagtatcccatcagtttaatctttcctttgaattaggaaaatgtgtggaaggtggctatgctgcttttttatggggaattgtttttacccttcggtgtctctggttgatacatgaattcagtgggtgtgtttaacattaacttctaagtattgtacaaaagtgccttaatttcagacatgcttacttgattcccttttgaaacactgtcttccctgttgtgagaggctggcaggatgttggggcaacatgggaaggaggatcaccctcagtgatcctgcatacaaaggtactttacaaacatagattactcttttggccacatacttgcaatcatctttctcccactgtcagtgcatcctgataaacaaaatgagggatcataagccaaggcagaaattatgagtgacagcactgcaaagggtcatttattctggagtgattaatacaaaattcaagggtgtaattgtctgggaattgtagcagattattgaagaagggaatctcttttgctttgtatgttggatggagggaatgttaagagagaattctcaggtgtgcattctctaggcccattgtgatcttaaatcaatcattaaattttgcattcttacacggta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]