ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-15 16:05:15, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_075371524 719 bp mRNA linear INV 16-JUL-2025 DEFINITION PREDICTED: Lycorma delicatula protein argonaute-1-like (LOC142328057), transcript variant X3, mRNA. ACCESSION XM_075371524 VERSION XM_075371524.1 DBLINK BioProject: PRJNA1291225 KEYWORDS RefSeq. SOURCE Lycorma delicatula (spotted lanternfly) ORGANISM Lycorma delicatula Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Paraneoptera; Hemiptera; Auchenorrhyncha; Fulgoroidea; Fulgoridae; Aphaeninae; Lycorma. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_134461) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_047948215.1-RS_2025_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.4 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/15/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..719 /organism="Lycorma delicatula" /mol_type="mRNA" /isolate="Av1" /isolation_source="Kean University campus" /db_xref="taxon:130591" /chromosome="7" /sex="female" /tissue_type="Whole Insect" /dev_stage="adult" /geo_loc_name="USA: Kean University, Union, NJ" /collection_date="2023-09-23" /collected_by="Brenna Levine" gene 1..719 /gene="LOC142328057" /note="protein argonaute-1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:142328057" CDS 72..611 /gene="LOC142328057" /codon_start=1 /product="protein argonaute-1-like isoform X2" /protein_id="XP_075227639.1" /db_xref="GeneID:142328057" /translation="
MFYSGYRFVAVGRSFFTPPQQEQIVDLGDGLELRYGFYQSAILGWKPFLNVDVAHKGFSKPENLIKVIRDQNATIGDRVFDKELDNWQKESLQKYIGGLKVEYEIPNQPDSKRTYKVNRVLGSSINQRFDLVEKVGDAQRTKNISVGQYLHQYKNFRLRYPNMPCLHVGPSQRNIFVPY"
misc_feature 99..245
/gene="LOC142328057"
/note="Argonaute linker 1 domain; Region: ArgoL1;
pfam08699"
/db_xref="CDD:462567"
misc_feature 258..605
/gene="LOC142328057"
/note="PAZ domain, argonaute_like subfamily. Argonaute is
part of the RNA-induced silencing complex (RISC), and is
an endonuclease that plays a key role in the RNA
interference pathway. The PAZ domain has been named after
the proteins Piwi,Argonaut, and Zwille; Region:
PAZ_argonaute_like; cd02846"
/db_xref="CDD:239212"
misc_feature order(414..416,456..458,507..509,519..521,573..575,
594..596,600..602)
/gene="LOC142328057"
/note="nucleic acid-binding interface [nucleotide
binding]; other site"
/db_xref="CDD:239212"
ORIGIN
gttgggattcgtcgaagtgaatatgagtgcagtgacgttgttcaaataactattcaggaggtttgcaatttatgttttattctggatacagatttgttgctgttgggcgttcattttttactccacctcagcaagaacaaattgttgatcttggagatggtttagaactacggtatggtttctaccaaagtgcgattcttggctggaagccatttcttaatgttgatgtcgcccacaaaggtttttcgaaaccagaaaatctaataaaagtaattagggatcaaaatgcaactattggtgatagagtatttgataaagagttagataattggcaaaaggagagtttacaaaagtatattggtggtctgaaagtggagtatgaaataccaaaccaacctgattctaaaagaacttacaaagttaatagagtgttgggaagtagtatcaatcagagatttgatttggttgaaaaagtcggagatgctcaaagaactaagaatattagtgtcggacagtatcttcatcagtataaaaacttcagacttagatatccaaatatgccttgtttacatgtcggaccatcacaaagaaacatatttgttccatattagttttaaagatatctgatgtaaaacacaaaaattggggataaaaaataacgcgtttttgggtttaatggaaaaaaactttgttaagtgtttaattaaggtatatatttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]