GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-29 09:13:03, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_071916129            1242 bp    mRNA    linear   VRT 07-MAR-2025
DEFINITION  PREDICTED: Centroberyx gerrardi vimentin-related 2 (vimr2), mRNA.
ACCESSION   XM_071916129
VERSION     XM_071916129.1
DBLINK      BioProject: PRJNA1232093
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Centroberyx gerrardi (bight redfish)
  ORGANISM  Centroberyx gerrardi
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Berycimorphaceae; Beryciformes; Berycidae;
            Centroberyx.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027303543) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_026898505.1-RS_2025_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/06/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1242
                     /organism="Centroberyx gerrardi"
                     /mol_type="mRNA"
                     /db_xref="taxon:166262"
                     /chromosome="Unknown"
     gene            1..1242
                     /gene="vimr2"
                     /note="vimentin-related 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:139924912"
     CDS             1..1242
                     /gene="vimr2"
                     /codon_start=1
                     /product="uncharacterized protein vimr2"
                     /protein_id="XP_071772230.1"
                     /db_xref="GeneID:139924912"
                     /translation="
MEMETPPHGFQGSLFSLVHTQPKAMLRVSSYRKLFEEDHWSRNGGFSMQCAGQYRASARGAAADKCDCDKLDFVAAKALNKEGLSRFVQDRTIIAALNDRLARLIELARCFEEENESLECQIMELEDRLEGQKASITTTVAVPDYSLDAVVSRLRKEKDETLCDTEELNKELERLKQEYEQAVQQRTFAQLERQDVAVEVDAVTAECLALREQVAIYEEQLANMEAQHKTAVETLLEPAAGTTGAVAAIEFGSPDITPALDIKEYYCQLAESLQCVCYECGASSSAVVANGDGRQMVIGGAAGSKVKGSPKIMDINELKKLISELQKELAELEKCNEELEDEIAMKKEAYMDEIAELECTIDEMRHQQVDHRAQMKEHCEDYEELLSEKMARDIEIAAYRGLMEEEEERLCNL"
     misc_feature    265..1227
                     /gene="vimr2"
                     /note="Intermediate filament protein; Region: Filament;
                     pfam00038"
                     /db_xref="CDD:459643"
ORIGIN      
atggagatggaaacaccgccgcatggatttcagggctcactcttcagcctagtccatacccagcccaaagccatgctgagagtgtcttcttaccgcaagttgtttgaggaggatcactggagtcgaaatggagggttcagtatgcagtgtgcagggcagtaccgcgcctccgccaggggtgcggccgctgacaagtgtgactgtgacaagttagactttgtggctgccaaggcactcaacaaggagggcctgagccggttcgtccaagaccgaaccattattgctgccctcaatgaccgcctggccagacttattgaactggctcgttgttttgaggaggagaatgagtctctggaatgtcagataatggaactagaggacaggcttgagggtcaaaaagcctccatcaccaccactgtggccgtgccggactacagcctggatgcagtggtgagcagactgcgcaaggagaaggatgagaccctgtgtgacactgaggagctgaacaaagagcttgagcgtctgaagcaggagtatgagcaggctgtgcagcagaggaccttcgcccagctggaacgccaggatgttgccgtggaagtggatgctgtgacggcagagtgtttggccctgagagagcaagtggcaatctatgaagagcagctggccaacatggaggcccagcacaagacggcagtggaaactcttctggaaccggctgcagggactacaggagcggtagcagctattgaatttggcagcccagacatcactccagccttggacataaaggagtactactgccagctggctgagagcctccagtgtgtgtgttatgagtgcggtgcatcctcctctgctgtggtcgccaatggagatggaaggcaaatggtgataggcggagctgcggggtcaaaggtcaaaggctcgcccaagataatggacatcaatgaactgaagaagctaatttcagagctacagaaggagcttgctgagcttgagaaatgcaatgaggagttggaggatgagattgccatgaagaaggaagcatacatggatgagattgcagagctggagtgtactatagatgagatgaggcaccagcaggttgaccaccgagcccagatgaaggagcactgtgaagactacgaggagctgctcagtgagaagatggccagagacattgagattgctgcctacaggggtctgatggaggaagaggaggagaggctgtgcaacctgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]