GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-10 20:22:52, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_071838241             564 bp    mRNA    linear   PLN 04-MAR-2025
DEFINITION  PREDICTED: Rutidosis leptorrhynchoides uncharacterized protein
            (LOC139848512), mRNA.
ACCESSION   XM_071838241
VERSION     XM_071838241.1
DBLINK      BioProject: PRJNA1220673
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Rutidosis leptorrhynchoides
  ORGANISM  Rutidosis leptorrhynchoides
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Asteroideae; Inuleae; Plucheinae; Rutidosis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_092337) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_046630445.1-RS_2025_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/28/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..564
                     /organism="Rutidosis leptorrhynchoides"
                     /mol_type="mRNA"
                     /isolate="AG116_Rl617_1_P2"
                     /db_xref="taxon:125765"
                     /chromosome="5"
                     /tissue_type="leaf"
                     /dev_stage="flowering"
                     /geo_loc_name="Australia: Truganina Cemetery, Victoria"
                     /collection_date="2024"
                     /collected_by="John Morgan"
     gene            1..564
                     /gene="LOC139848512"
                     /note="uncharacterized LOC139848512; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:139848512"
     CDS             1..564
                     /gene="LOC139848512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_071694342.1"
                     /db_xref="GeneID:139848512"
                     /translation="
MKMLSLNIRGFGGEDKEGKLNWVRKLCRVEKPDVIFIQETKLHTVDLRWIRRIWGNNNCNFIQKAMVGKSGGQLIIWDVNRYEATDPFVSNFFIGLRGKWKVSGECCNLINVYGPHKDANKKRLWEQLTNVLENCDSPWIIGGDFNEVREQDDRFNCNFIEYRARWFNKFIEENKLIDLPIGGRKYM"
     misc_feature    13..>537
                     /gene="LOC139848512"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:469791"
ORIGIN      
atgaagatgctatctttaaatattcgtggttttgggggtgaggataaagaagggaaactcaattgggttagaaaattgtgtcgtgttgagaaaccggatgttatttttatacaagaaacaaagcttcatactgtcgatctgagatggattcgaagaatttggggaaacaacaactgtaatttcattcagaaagctatggtggggaaatcgggtgggcaacttattatttgggatgttaatcgttatgaggctactgatcctttcgtgtcaaatttttttattggtctacgaggtaaatggaaagtttctggagaatgctgcaacctcataaatgtttacggacctcataaagatgcaaacaagaagagattgtgggaacagcttactaacgtacttgaaaactgtgactctccttggatcattggtggtgattttaatgaggttcgggaacaggatgacagattcaattgcaactttattgaatacagggcccggtggttcaataagtttatagaggaaaacaagctgattgatttgcctataggtgggaggaagtatatgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]