ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-05-10 20:22:52, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_071838241 564 bp mRNA linear PLN 04-MAR-2025
DEFINITION PREDICTED: Rutidosis leptorrhynchoides uncharacterized protein
(LOC139848512), mRNA.
ACCESSION XM_071838241
VERSION XM_071838241.1
DBLINK BioProject: PRJNA1220673
KEYWORDS RefSeq; includes ab initio.
SOURCE Rutidosis leptorrhynchoides
ORGANISM Rutidosis leptorrhynchoides
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
Asteroideae; Inuleae; Plucheinae; Rutidosis.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_092337) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_046630445.1-RS_2025_02
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.3
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 02/28/2025
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..564
/organism="Rutidosis leptorrhynchoides"
/mol_type="mRNA"
/isolate="AG116_Rl617_1_P2"
/db_xref="taxon:125765"
/chromosome="5"
/tissue_type="leaf"
/dev_stage="flowering"
/geo_loc_name="Australia: Truganina Cemetery, Victoria"
/collection_date="2024"
/collected_by="John Morgan"
gene 1..564
/gene="LOC139848512"
/note="uncharacterized LOC139848512; Derived by automated
computational analysis using gene prediction method:
Gnomon. Supporting evidence includes similarity to: 2
Proteins"
/db_xref="GeneID:139848512"
CDS 1..564
/gene="LOC139848512"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_071694342.1"
/db_xref="GeneID:139848512"
/translation="
MKMLSLNIRGFGGEDKEGKLNWVRKLCRVEKPDVIFIQETKLHTVDLRWIRRIWGNNNCNFIQKAMVGKSGGQLIIWDVNRYEATDPFVSNFFIGLRGKWKVSGECCNLINVYGPHKDANKKRLWEQLTNVLENCDSPWIIGGDFNEVREQDDRFNCNFIEYRARWFNKFIEENKLIDLPIGGRKYM"
misc_feature 13..>537
/gene="LOC139848512"
/note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
superfamily; Region: EEP; cl00490"
/db_xref="CDD:469791"
ORIGIN
atgaagatgctatctttaaatattcgtggttttgggggtgaggataaagaagggaaactcaattgggttagaaaattgtgtcgtgttgagaaaccggatgttatttttatacaagaaacaaagcttcatactgtcgatctgagatggattcgaagaatttggggaaacaacaactgtaatttcattcagaaagctatggtggggaaatcgggtgggcaacttattatttgggatgttaatcgttatgaggctactgatcctttcgtgtcaaatttttttattggtctacgaggtaaatggaaagtttctggagaatgctgcaacctcataaatgtttacggacctcataaagatgcaaacaagaagagattgtgggaacagcttactaacgtacttgaaaactgtgactctccttggatcattggtggtgattttaatgaggttcgggaacaggatgacagattcaattgcaactttattgaatacagggcccggtggttcaataagtttatagaggaaaacaagctgattgatttgcctataggtgggaggaagtatatgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]