LOCUS       XM_071745684            1734 bp    mRNA    linear   VRT 03-MAR-2025
DEFINITION  PREDICTED: Heliangelus exortis dicer 1, ribonuclease III (DICER1),
            transcript variant X8, mRNA.
ACCESSION   XM_071745684
VERSION     XM_071745684.1
DBLINK      BioProject: PRJNA1226279
KEYWORDS    RefSeq.
SOURCE      Heliangelus exortis
  ORGANISM  Heliangelus exortis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Strisores; Apodiformes;
            Trochilidae; Heliangelus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_092426) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036169615.1-RS_2025_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/24/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1734
                     /organism="Heliangelus exortis"
                     /mol_type="mRNA"
                     /db_xref="taxon:472823"
                     /chromosome="5"
     gene            1..1734
                     /gene="DICER1"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     ESTs, 3 long SRA reads, 2 Proteins"
                     /db_xref="GeneID:139796986"
     CDS             355..1734
                     /gene="DICER1"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X2"
                     /protein_id="XP_071601785.1"
                     /db_xref="GeneID:139796986"
                     /translation="

MKSPALQSLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNKNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSSLETTESWTKEKWSQEFSKHQVLVMTCHVALSVLRNEYLSLSNINLLVFDECHLAIQNHPYREIMKICEDYPSCPRILGLTASILNGKCDPADLEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPYTDKSGLYGRLLKELDEALTFLNDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"

     misc_feature    478..1071
                     /gene="DICER1"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(478..489,496..498,547..570,691..693,880..882,
                     973..975)
                     /gene="DICER1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(655..660,727..732,805..807,811..816,823..825,
                     898..906)
                     /gene="DICER1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1171..1449
                     /gene="DICER1"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(1180..1185,1192..1194,1198..1203,1378..1383,
                     1390..1395,1402..1404,1411..1416,1423..1425)
                     /gene="DICER1"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    1468..>1731
                     /gene="DICER1"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      

gcccaggtgaatggaggaacctgacagtttcggggagtgaggcggcggcgacggggaaatggcggcggcggcggcagcggcacaatgagacgcggcctgtagtggagggaagcgccgggctgggtcccgtccgagcaggttacctagggtgaaacaaaattacaggcttggagactctggaaaagctcagcatcagcatttgagagccgaagcttgcaaattatgtgattaatctacaagctgatatcatgatgtcaaaatgcagtttggaaagcataaacacagagactgcggaaattaaaacgtaggctgtgctggaacaaaaatgcaatgaaagaaacactggatgaatgaatgaaaagccctgctttgcaatccctcagcatggcaggactacagctcatgacccctgcttcctccccaatgggtccattttttggattaccatggcaacaagaagcaattcatgataacatttacacgccaagaaaatatcaggttgaactgcttgaagcagctttggatcataatacaatagtctgcttaaacactggctcagggaagacttttattgcagtactactcactaaagagctgtcctatcagatcaggggagatttcaacaaaaatggaaaaagaactgtgttcttggtcaactcagcaaatcaagttgctcaacaagtatcagctgtcaggacacattcagatcttaaagtgggagagtattcaagtttagagacgactgaatcatggacaaaagagaagtggagtcaggaattctctaagcatcaggttctagttatgacatgtcatgttgctttgagtgttttgagaaatgagtatttatccctgtcaaatattaatcttctggtgtttgatgaatgccatcttgcaatccagaatcacccataccgtgaaattatgaagatctgtgaggattatccatcgtgtcctcgaatcttgggattaacagcatcaattttaaatgggaaatgtgatcctgctgatttagaagaaaagatccagaaactggagaaaattttaaagagcaatgctgaaaccgcaactgatttggtggtcttagacagatatacttctcagccatgtgagattgttgtagactgtggaccatatactgacaaaagtggattgtatggaagattattgaaggagttggatgaagcccttacttttctaaatgactgcaacatatctgtacattcaaaagaaagagattctacgttaatttcaaagcagatactgtcagactgtcgagctgtgttggttgttctgggaccgtggtgtgcagataaggtagctgggatgatggtgagagagctgcagaagtatatcaaacatgaacaagaggagctgcacaggaaatttttattgtttacagacactttcctaaggaaaatccatgcactctgtgaagagcacttctcgcctgcctcacttgacctgaaatttgtaaccccaaaagtaataaagctgcttgaaatcttgcgcaaatataaaccatatgaacggcagcagtttgaaagtgttgaatggtataacaataggaatcaggataattacgtatcttggagtgattctgaagatgatgatgaggatgaagaaatagaggagaaagagaagccagagactaatttcccatctcctttcactaatattttatgtggaatcattttcgtggagagaagatacacggcagttgttctaaataggtaa

//