2025-07-01 01:55:45, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_071244935 984 bp mRNA linear INV 13-FEB-2025 DEFINITION PREDICTED: Haliotis cracherodii uncharacterized protein slr1819-like (LOC139463678), mRNA. ACCESSION XM_071244935 VERSION XM_071244935.1 DBLINK BioProject: PRJNA1220611 KEYWORDS RefSeq; includes ab initio. SOURCE Haliotis cracherodii (black abalone) ORGANISM Haliotis cracherodii Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Vetigastropoda; Lepetellida; Haliotoidea; Haliotidae; Haliotis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027266271) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_022045235.1-RS_2025_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/12/2025 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..984 /organism="Haliotis cracherodii" /mol_type="mRNA" /isolate="W230" /db_xref="taxon:6455" /chromosome="Unknown" /tissue_type="Epipodial tissue" /dev_stage="adult" /collection_date="2020-07-20" /collected_by="Blythe Marshman" gene 1..984 /gene="LOC139463678" /note="uncharacterized protein slr1819-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:139463678" CDS 1..984 /gene="LOC139463678" /codon_start=1 /product="uncharacterized protein slr1819-like" /protein_id="XP_071101036.1" /db_xref="GeneID:139463678" /translation="
MNPFNCDSVTMNLVTVNLVTLNLLTVNLVTVNLVTVNLVTVNLVTVNLVTLNFVTVNLVTVNLVTMNLVTVNLVTLNLVTMNLVTVNLVTLNPVTMNLVTVNLVTLNLVTLNLVTMNLVTLNLVTVNLVTLNLLTVNLVTVNLVTLNLVTVNFVTVNLVTVNLVTVNFVNLVTVNLVVTVNFVTVNLVTMNFVNLVTVNLVTVNLVTVNLVNLVTVNLVTVNFVTVNLLTMNLVTVNLVTVNLVTMNLVTVNLETVNFVNLVTVNLVTVNFVTMKLVTLNLVTMNLVTVNSVTVNFVTVNLVTMNLVTMNFVTVNLVRVEGLLNQTL"
ORIGIN
atgaacccctttaactgtgacagtgtgaccatgaaccttgtgaccgtgaaccttgtgaccttaaaccttttgaccgtgaaccttgtgacagtgaaccttgtgaccgtgaaccttgtgacagtgaaccttgtgacagtgaaccttgtgaccttgaactttgtgacagtgaaccttgtgacagtgaaccttgtgaccatgaaccttgtgacagtgaaccttgtgaccttgaaccttgtgaccatgaaccttgtgaccgtgaaccttgtgaccttaaaccctgtgacaatgaaccttgtgaccgtgaaccttgtgaccttaaaccttgtgaccttgaaccttgtgaccatgaaccttgtgaccttgaaccttgtgaccgtgaaccttgtgaccttaaaccttttgaccgtgaaccttgtgacagtgaaccttgtgaccttgaaccttgtgaccgtgaactttgtgaccgtgaaccttgtgacagtgaaccttgtgacagtgaactttgtgaaccttgtgactgtgaaccttgttgtgacagtgaactttgtgaccgtgaaccttgtgaccatgaactttgtgaaccttgtgaccgtgaaccttgtgacagtgaatcttgtgaccgtgaaccttgtgaaccttgtgaccgtgaaccttgtgacagtgaactttgtgaccgtgaaccttttgaccatgaaccttgtgacagtgaaccttgtgaccgtgaaccttgtgaccatgaaccttgtgacagtgaaccttgagaccgtgaactttgtgaaccttgtgaccgtgaaccttgtgacagtgaactttgtgaccatgaagcttgtgaccttgaaccttgtgaccatgaaccttgtgacagtgaactctgtgacagtgaactttgtgacagtgaaccttgtgaccatgaaccttgtgaccatgaactttgtgacagtgaatcttgtaagagttgagggtttactgaatcaaactttgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]