GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-09 20:41:48, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_071155182            1119 bp    mRNA    linear   VRT 03-FEB-2025
DEFINITION  PREDICTED: Oncorhynchus clarkii lewisi clumping factor A-like
            (LOC139409806), mRNA.
ACCESSION   XM_071155182
VERSION     XM_071155182.1
DBLINK      BioProject: PRJNA1214367
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Oncorhynchus clarkii lewisi (westslope cutthroat trout)
  ORGANISM  Oncorhynchus clarkii lewisi
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_092151) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_045791955.1-RS_2025_01
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/30/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1119
                     /organism="Oncorhynchus clarkii lewisi"
                     /mol_type="mRNA"
                     /isolate="Uvic-CL-2024"
                     /sub_species="lewisi"
                     /db_xref="taxon:490388"
                     /chromosome="5"
                     /sex="male"
                     /tissue_type="milt"
                     /dev_stage="Spawning - Adult"
                     /geo_loc_name="Canada: Connor Lake, BC"
                     /collection_date="2023-06-13"
     gene            1..1119
                     /gene="LOC139409806"
                     /note="clumping factor A-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:139409806"
     CDS             1..1119
                     /gene="LOC139409806"
                     /codon_start=1
                     /product="clumping factor A-like"
                     /protein_id="XP_071011283.1"
                     /db_xref="GeneID:139409806"
                     /translation="
MQNEPCRPGGVPRVQDKQVIMKVLEEVDYGPHQGHNARDEPISSETDGDEPISSETDGDEPISSETDGDEPISFETDRDEPISSETDRDEPISFETDRDEPISSETDRDEPISSETDRDEPISSETDGDEPISSETDRDEPISSETDGDEPISSETDRDEPISSETDRDEPISSETDGDEPISFETDRDEPISFETDRDEPISFETDIDEPIETDGDEPISSETDRDEPISSETDGDEPISSETDGDEPIETDGDEPIETDGDEPIETDGDEPISSETDRDEPISSETDGDEPIETDRDEPISSETDRDEPISPETDGDEPISFETDRDEPISSETDRDEPISSETDRDEPISSETDGDEPISSETDSKAPN"
ORIGIN      
atgcagaacgaaccctgccgacccgggggcgtgccacgcgtacaggacaagcaggtcatcatgaaagtgcttgaagaggttgattatggcccacatcaaggtcacaatgccagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttttgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttttgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttttgagaccgacagggatgaaccaatctcttttgagaccgacagggatgaaccaatctcttttgagaccgacatcgatgaaccaatcgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacggcgatgaaccaatcgagaccgacggcgatgaaccaatcgagaccgacggcgatgaaccaatcgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatcgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctctcctgagaccgacggtgatgaaccaatctcttttgagaccgacagagatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttccgagaccgacagtaaggcaccaaattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]