2025-07-01 00:21:53, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_071155182 1119 bp mRNA linear VRT 03-FEB-2025 DEFINITION PREDICTED: Oncorhynchus clarkii lewisi clumping factor A-like (LOC139409806), mRNA. ACCESSION XM_071155182 VERSION XM_071155182.1 DBLINK BioProject: PRJNA1214367 KEYWORDS RefSeq; includes ab initio. SOURCE Oncorhynchus clarkii lewisi (westslope cutthroat trout) ORGANISM Oncorhynchus clarkii lewisi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_092151) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_045791955.1-RS_2025_01 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/30/2025 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1119 /organism="Oncorhynchus clarkii lewisi" /mol_type="mRNA" /isolate="Uvic-CL-2024" /sub_species="lewisi" /db_xref="taxon:490388" /chromosome="5" /sex="male" /tissue_type="milt" /dev_stage="Spawning - Adult" /geo_loc_name="Canada: Connor Lake, BC" /collection_date="2023-06-13" gene 1..1119 /gene="LOC139409806" /note="clumping factor A-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:139409806" CDS 1..1119 /gene="LOC139409806" /codon_start=1 /product="clumping factor A-like" /protein_id="XP_071011283.1" /db_xref="GeneID:139409806" /translation="
MQNEPCRPGGVPRVQDKQVIMKVLEEVDYGPHQGHNARDEPISSETDGDEPISSETDGDEPISSETDGDEPISFETDRDEPISSETDRDEPISFETDRDEPISSETDRDEPISSETDRDEPISSETDGDEPISSETDRDEPISSETDGDEPISSETDRDEPISSETDRDEPISSETDGDEPISFETDRDEPISFETDRDEPISFETDIDEPIETDGDEPISSETDRDEPISSETDGDEPISSETDGDEPIETDGDEPIETDGDEPIETDGDEPISSETDRDEPISSETDGDEPIETDRDEPISSETDRDEPISPETDGDEPISFETDRDEPISSETDRDEPISSETDRDEPISSETDGDEPISSETDSKAPN"
ORIGIN
atgcagaacgaaccctgccgacccgggggcgtgccacgcgtacaggacaagcaggtcatcatgaaagtgcttgaagaggttgattatggcccacatcaaggtcacaatgccagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttttgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttttgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttttgagaccgacagggatgaaccaatctcttttgagaccgacagggatgaaccaatctcttttgagaccgacatcgatgaaccaatcgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttctgagaccgacggcgatgaaccaatcgagaccgacggcgatgaaccaatcgagaccgacggcgatgaaccaatcgagaccgacggcgatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatcgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctctcctgagaccgacggtgatgaaccaatctcttttgagaccgacagagatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacagggatgaaccaatctcttctgagaccgacggcgatgaaccaatctcttccgagaccgacagtaaggcaccaaattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]