2025-08-29 09:14:58, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_070913843 1409 bp mRNA linear VRT 24-JAN-2025 DEFINITION PREDICTED: Enoplosus armatus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_070913843 VERSION XM_070913843.1 DBLINK BioProject: PRJNA1214866 KEYWORDS RefSeq. SOURCE Enoplosus armatus ORGANISM Enoplosus armatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Centrarchiformes; Centrarchoidei; Enoplosidae; Enoplosus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_092189) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_043641665.1-RS_2025_01 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/23/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1409 /organism="Enoplosus armatus" /mol_type="mRNA" /isolate="fEnoArm2" /specimen_voucher="WAM P35492.002" /db_xref="taxon:215367" /chromosome="10" /tissue_type="Gills and Liver" /dev_stage="adult" /geo_loc_name="Australia: Western Australia, Middle Island" /collection_date="2023-04-01" gene 1..1409 /gene="vimr2" /note="vimentin-related 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:139291737" CDS 1..1155 /gene="vimr2" /codon_start=1 /product="alpha-internexin" /protein_id="XP_070769944.1" /db_xref="GeneID:139291737" /translation="
MAMLRVSSYRKLFEDDNRSRSGWCARQYRTSVRAAAVDDCDCDKLDFVAAKVLNKEGLIRFVQDRTIIAALNDRLVRLIELAHCFEEENESLECQIVQLEEKLSSRQASSSITSAVAEPDYSLDAVVERLRRERDETLYNTEEMQKELGRLMKEYEKAAQQRVLFQQERQDVAQEVDAVTAECLALREQVAIYEEQLANMGAQHNTEVENLLEPAEWTTGAAAAIKFGSPDITPALDVKEYYCQLAESLQYECGAASSAVVLRGDGRQLEVGGAAGSADSPTMKDISEMKMLISELQKELAELEKCNEELEDEVEMKKAAHTDEIAELECTIDEMRHQEADFQVQMKEQCEDYKELLSEKMARDMEITAYRSLVEEEEERLCNL"
misc_feature 187..1140 /gene="vimr2" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:459643" ORIGIN
atggccatgctcagagtgtcttcgtaccgcaagctgtttgaggatgataacaggagtcgaagcggatggtgtgcaaggcagtaccggacctccgtcagggcagcggccgttgacgactgcgactgtgacaagttagactttgtagctgccaaggtgctcaacaaggagggtctgatccggtttgtccaggaccgcaccatcatcgctgccctcaatgaccgcctggtcaggcttattgaactggcccattgttttgaggaggagaatgagtctctcgaatgtcagattgttcaactagaggagaagctgagcagtcgacaagcctcctccagcatcacctccgctgtggccgagcctgactacagtctggatgcggtggtggaaagactgcgcagggagagggatgagactctgtacaacacagaggagatgcagaaagagctcggacgtctgatgaaagagtacgagaaggctgcacagcagagggtcctcttccagcaggagcgacaagatgttgctcaggaagtggatgctgtgacagcagagtgtttggcgctgagggagcaagtggctatctatgaggagcagctggccaacatgggggcccagcacaacacggaagtggagaatctgctggagccggccgaatggaccacaggagcggcggcagctattaaatttggcagccctgacatcactccggccttggacgtaaaggagtactactgccagctggctgagagcctgcagtacgagtgtggcgcagcctcttctgctgtggttctcaggggtgatggaagacaactggaagtgggaggagctgcagggtcagcagattcgccaacgatgaaggacatcagtgagatgaagatgctgatttcagagctacaaaaggagcttgctgagctcgagaagtgtaacgaggagctggaggacgaggttgagatgaagaaggctgcacacacggacgagattgctgagctggagtgtactatagatgaaatgcggcaccaggaggctgacttccaagtgcagatgaaggagcagtgtgaagactacaaggagctgctcagtgagaagatggccagagacatggaaatcactgcttacaggagtctggtggaggaagaggaggagaggctgtgcaacctgtgatttgaggccggagagtcagactggctggctggctggagtgtggctggatgcttcccccacacatggattagaaaatacacataaagggaaatgcgaaaaacacacacacccaaataagcactaggatggagcttaaggttccaaagcagcaatttaagcagatgtaaacttatcatgacagattaatgccgtctggatgcctaagccgggccattgataacaggtcgctggcagatgaccctgagactccaaga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]