LOCUS       XM_070775634            1729 bp    mRNA    linear   MAM 07-JAN-2025
DEFINITION  PREDICTED: Bos indicus dicer 1, ribonuclease III (DICER1),
            transcript variant X7, mRNA.
ACCESSION   XM_070775634
VERSION     XM_070775634.1
DBLINK      BioProject: PRJNA1197407
KEYWORDS    RefSeq.
SOURCE      Bos indicus (Bos taurus indicus)
  ORGANISM  Bos indicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091780) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_029378745.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/12/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1729
                     /organism="Bos indicus"
                     /mol_type="mRNA"
                     /isolate="NIAB-ARS_2022"
                     /db_xref="taxon:9915"
                     /chromosome="21"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="calf"
                     /collected_by="NIAB"
                     /breed="Sahiwal x Tharparkar"
                     /note="offspring of Sahiwal sire and Tharparkar dam"
     gene            1..1729
                     /gene="DICER1"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:109575356"
     CDS             350..1729
                     /gene="DICER1"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X2"
                     /protein_id="XP_070631735.1"
                     /db_xref="GeneID:109575356"
                     /translation="

MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVSASWTKEKWNQEFTKHQVLVMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"

     misc_feature    473..1066
                     /gene="DICER1"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(473..484,491..493,542..565,686..688,875..877,
                     968..970)
                     /gene="DICER1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(650..655,722..727,800..802,806..811,818..820,
                     893..901)
                     /gene="DICER1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1160..1444
                     /gene="DICER1"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(1175..1180,1187..1189,1193..1198,1373..1378,
                     1385..1390,1397..1399,1406..1411,1418..1420)
                     /gene="DICER1"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    1463..>1726
                     /gene="DICER1"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      

gggacgaggcgacggcgagcgggaggacatggcggcggcggcggcggcgccgggcggcaccgggaggcctgggctgtgacgcgcgcgccggagcgggggtccgatggttctcgaaggcccgcggcgccccgtgctgcaggttacctagggtatgaattaatacagacttggaaactgaaagaacttagaatcagcattttgagagcagaagcttgggtatgctgtgattttccaataaactgctatcacaatgtcaaaatgcagttcagacaacagcaacacagagatctcaaacattaagacgtaagctgtgctagaacaaaaatgcaatgaaagagacactggatgaatgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgcttcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataataccatagtctgtttaaacactggctcagggaagacgtttattgcagtactactcactaaagagctgtcttatcagatcaggggagacttcaacagaaatggcaaaaggacggtgttcttggtcaactctgcaaaccaggttgcccaacaagtgtcagctgtcagaactcactcagatctcaaggtcggggaatactcaaacctagaagtaagtgcatcttggacaaaagagaaatggaaccaagagtttactaaacatcaggttctcgttatgacttgctatgtcgccttgaatgttttgaaaaatggttacttatcactgtcagacattaaccttttggtgtttgatgagtgtcatcttgcaatcctagaccacccctaccgagaaattatgaagctttgtgaaaattgtccatcatgtcctcgtattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaagagaagattcagaaactggagaaaattcttaagagtaatgctgaaactgcaactgacttggtggtcttagacagatatacttctcagccatgtgagattgtggtagactgtggaccatttactgacagaagtgggctttatgaaagactgctgatggagttagaagaagcacttaattttatcaatgactgtaacatatctgtacattcaaaagaaagagattctactttaatttctaaacagatactctcagactgccgtgcggtcctggttgtcctgggaccctggtgtgccgataaagtagctggaatgatggtcagagagctgcagaaacacatcaaacatgagcaggaggagctgcaccggaagtttctgttgttcacagacactttcctacggaaaatccacgccctgtgtgaagagcacttctcccctgcctcgcttgacctgaagtttgtcactcctaaagtaataaagctgctcgagatcttacgcaaatacaaaccgtatgagcggcagcagtttgaaagcgtggagtggtataataataggaaccaggataattacgtgtcctggagcgattctgaggatgacgaggaagatgaagagattgaagagaaagaaaagccagagacaaattttccttctccgtttaccaacattttgtgtggaattatttttgtggaaagaagatacacagccgtggtcttaaacaggtaa

//