LOCUS       XM_070378253            1833 bp    mRNA    linear   MAM 12-DEC-2024
DEFINITION  PREDICTED: Bos mutus Meis homeobox 2 (MEIS2), transcript variant
            X4, mRNA.
ACCESSION   XM_070378253
VERSION     XM_070378253.1
DBLINK      BioProject: PRJNA1191006
KEYWORDS    RefSeq.
SOURCE      Bos mutus (wild yak)
  ORGANISM  Bos mutus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091626) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_027580195.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/05/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1833
                     /organism="Bos mutus"
                     /mol_type="mRNA"
                     /isolate="GX-2022"
                     /db_xref="taxon:72004"
                     /chromosome="10"
                     /sex="male"
                     /tissue_type="blood"
     gene            1..1833
                     /gene="MEIS2"
                     /note="Meis homeobox 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:102278085"
     CDS             454..1656
                     /gene="MEIS2"
                     /codon_start=1
                     /product="homeobox protein Meis2 isoform X4"
                     /protein_id="XP_070234354.1"
                     /db_xref="GeneID:102278085"
                     /translation="

MFLYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"

     misc_feature    778..1032
                     /gene="MEIS2"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    order(1294..1296,1423..1425,1432..1437,1444..1446)
                     /gene="MEIS2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    1333..1449
                     /gene="MEIS2"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      

ggcggccagtattttaaaaaaatagcagcaaaattattcatcggcttcttttcccccccgtgcctctgcgtgtgtgcgagtgtgtgtgcgtgcgtgtgtgcgtgtctgggcgcgcgtgtttcagcgctgtgcgagcgggcgggcggcgagtgcgtgtgagtggtgtgtgtgtgtgtgcgagtgcaattgttacacgctttcgcctcgctccagcttttaccccagcagcgcgattcccccggttctcctgctgccgccgctgccgctgctgcgccgctgctgccgctgctcccgcggctcggggcgggcaccggctgcgtaggagccgccgccgccgccggggccgccgctggggccgcgctgccgcagccgctgcgccgccgcctagactagcctgggctgcttgttttgtctctgaaattgacaaggacgcagggaatccgctgctaaataatgtttctgtacgatgagctgccccattacggcgggatggacggagtaggggtgcctgcttccatgtacggagaccctcacgcgccgcggccgatccctccggttcaccacctgaaccacgggccgccgcttcacgccacgcagcactacggcgctcacgccccgcaccccaatgtcatgccggccagtatgggatccgctgtcaacgacgccttgaagcgggacaaggacgcgatctatgggcacccgttgtttcctctgttagctctggtctttgagaagtgcgagctggcgacctgcactccgcgggaacccggagtggccggcggagacgtctgctcctccgactctttcaacgaggacatcgcggtcttcgccaagcaggttcgcgccgaaaagccacttttttcctcaaatccagagctggacaatttgatgatacaagcaatacaagtactaaggtttcaccttttggagttagaaaaggtccatgaactgtgtgataacttctgccaccggtacattagctgtttgaaggggaaaatgcctatagacctcgtcattgatgaaagagacggcagctccaagtcggatcacgaagaactttcgggctcctccacaaatctcgctgaccataatcctgcatcttggcgagaccatgatgatgcaacttccacccattcagcaggcaccccagggccctccagtgggggccatgcgtcccagagtggagacaacagcagtgagcaaggggatggtttagacaacagtgtagcttcacctggcacaggtgacgatgatgatccagacaaggacaaaaaacgtcagaagaaaagaggcattttccccaaagtagcaacaaatatcatgagagcatggctcttccagcatctcacacatccgtacccttccgaagagcagaagaaacagttagctcaagatacaggacttacaattctccaagtaaacaactggtttattaatgccagaagaagaatagtacagcccatgattgaccagtcaaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcgtatagtccagagggtcagcccatggggagctttgtgttggatggtcagcaacacatgggaatccggcctgcaggacctatgagtggaatgggcatgaatatgggcatggatgggcaatggcactacatgtaaccttcaccatgtaaagcaatcgcaaagccgggggaagtttgcagagcatgccaggggagtacgtttctcagggtggtcctatgggaatgagtatggcacagccaagttacactcctccccagatgaccccacaccctactcaattaagacatggacccccaatgcattcatatttgc

//