LOCUS       XM_070357904            2480 bp    mRNA    linear   MAM 12-DEC-2024
DEFINITION  PREDICTED: Bos mutus dicer 1, ribonuclease III (DICER1), transcript
            variant X8, mRNA.
ACCESSION   XM_070357904
VERSION     XM_070357904.1
DBLINK      BioProject: PRJNA1191006
KEYWORDS    RefSeq.
SOURCE      Bos mutus (wild yak)
  ORGANISM  Bos mutus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091637) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_027580195.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/05/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2480
                     /organism="Bos mutus"
                     /mol_type="mRNA"
                     /isolate="GX-2022"
                     /db_xref="taxon:72004"
                     /chromosome="21"
                     /sex="male"
                     /tissue_type="blood"
     gene            1..2480
                     /gene="DICER1"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:102270004"
     CDS             1101..2480
                     /gene="DICER1"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X4"
                     /protein_id="XP_070214005.1"
                     /db_xref="GeneID:102270004"
                     /translation="

MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVSASWTKEKWNQEFTKHQVLVMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"

     misc_feature    1224..1817
                     /gene="DICER1"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(1224..1235,1242..1244,1293..1316,1437..1439,
                     1626..1628,1719..1721)
                     /gene="DICER1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(1401..1406,1473..1478,1551..1553,1557..1562,
                     1569..1571,1644..1652)
                     /gene="DICER1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1911..2195
                     /gene="DICER1"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(1926..1931,1938..1940,1944..1949,2124..2129,
                     2136..2141,2148..2150,2157..2162,2169..2171)
                     /gene="DICER1"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    2214..>2477
                     /gene="DICER1"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      

ggggccgctgccctcatctcattttctggtcatcctagttccgggttggggatggggtgggttgggggaaggaggtggggttaattgtcttccctaatacggagggccctggaccacaaaccctggggaaatgcaggcgagtgggacggtcctttaaaaaggggatggggcggtgaaaaagagcgccgagctctcgggagaacaattaacggccaaggcgaagggccacgtttagggggcggtccgtgccagaaggggcaaccatgaaggcggacgaattccgagcgccagcagaattctcgccgagccaagcgagcgtccgcaggccgggcgtgcaggcaccgggcgggcggcgaaggtgcctggcctccgcgcgggcccgctgaacgtccacgtccagccccggctcctccgggccgcaaacaccgccaggggcctctgccgctcgcgtccactgtctcccggctcctgagtggctggggggccgggattaacctttcaccgccgcgcgctgtccaatcacaggctcgctctcatgccggcgcggggcgagcgggggagagcgggggcgcgggcgccggggagattctccaagccgccgtgcgccgttgccgcggggccgtgcgcgggccgcgagcgagccgggcgctgcgcagtctccgcaggcgccggcgggaggggtcgaggctcggaggcgcggcgcggcgcgggctgctccaggccccaggttggatggagtgacctgacagcggggacgaggcgacggcgagcgggaggacatggcggcggcggcggcggcgccgggcggcaccgggaggcctgggctgtgacgcgcgcgccggagcgggggtccgatggttctcgaaggcccgcggcgccccgtgctgcaggttacctagggtatgaattaatacagacttggaaactgaaagaacttagaatcagcattttgagagcagaagcttgggtatgctgtgattttccaataaactgctatcacaatgtcaaaatgcagttcagacaacagcaacacagagatctcaaacattaagacgtaagctgtgctagaacaaaaatgcaatgaaagagacactggatgaatgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgcttcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataataccatagtctgtttaaacactggctcagggaagacgtttattgcagtactactcactaaagagctgtcttatcagatcaggggagacttcaacagaaatggcaaaaggacggtgttcttggtcaactctgcaaaccaggttgcccaacaagtgtcagctgtcagaactcactcagatctcaaggtcggggaatactcaaacctagaagtaagtgcatcttggacaaaagagaaatggaaccaagagtttactaaacatcaggttctcgttatgacttgctatgtcgccttgaatgttttgaaaaatggttacttatcactgtcagacattaaccttttggtgtttgatgagtgtcatcttgcaatcctagaccacccctaccgagaaattatgaagctttgtgaaaattgtccatcatgtcctcgtattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaagaaaagattcagaaactggagaaaattcttaagagtaatgctgaaactgcaactgacttggtggtcttagacagatatacttctcagccatgtgagattgtggtagactgtggaccatttactgacagaagtgggctttatgaaagactgctgatggagttagaagaagcacttaattttatcaatgactgtaacatatctgtacattcaaaagaaagagattctactttaatttctaaacagatactctcagactgccgtgcggtcctggttgtcctgggaccctggtgtgccgataaagtagctggaatgatggtcagagagctgcagaaacacatcaaacatgagcaagaggagctgcaccggaagtttctgttgttcacagacactttcctacggaaaatccacgccctgtgtgaagagcacttctcccctgcctcgcttgacctgaagtttgtcactcctaaagtaataaagctgctcgagatcttacgcaaatacaaaccgtatgagcggcagcagtttgaaagcgtggagtggtataataataggaaccaggataattacgtgtcctggagcgattctgaggatgacgaggaagatgaagagattgaagagaaagaaaagccagagacaaattttccttctccgtttaccaacattttgtgtggaattatttttgtggaaagaagatacacagccgtggtcttaaacaggtaa

//