LOCUS       XM_070120056             552 bp    mRNA    linear   INV 03-DEC-2024
DEFINITION  PREDICTED: Penaeus vannamei uncharacterized protein (LOC113823412),
            mRNA.
ACCESSION   XM_070120056
VERSION     XM_070120056.1
DBLINK      BioProject: PRJNA1188530
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Penaeus vannamei (Pacific white shrimp)
  ORGANISM  Penaeus vannamei
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027215123) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_042767895.1-RS_2024_11
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 11/26/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..552
                     /organism="Penaeus vannamei"
                     /mol_type="mRNA"
                     /isolate="JL-2024"
                     /db_xref="taxon:6689"
                     /chromosome="Unknown"
                     /tissue_type="muscle"
                     /geo_loc_name="China: Zhanjiang"
                     /collection_date="2023-06-18"
                     /collected_by="Liao Jian"
     gene            1..552
                     /gene="LOC113823412"
                     /note="uncharacterized LOC113823412; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:113823412"
     CDS             1..552
                     /gene="LOC113823412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_069976157.1"
                     /db_xref="GeneID:113823412"
                     /translation="

MDTPSYPRTPLGTHAHPVIATDTPWYPWTPPHTHGHSLVPSEHPLTPTDTPWYPRTPAPPHTHGHPLDPRAPSHTHGHPLVPSEHPLIPTDTLAPPHTHGHPLVPTDTLEHPLIPTDTPWYPLSTPSYPRTPLGTHGHPRAPSHTHGHPLVPSEHPLIPTDTPWYPRTPSSTPSYPRTLPGTS"

     misc_feature    <19..>387
                     /gene="LOC113823412"
                     /note="DNA translocase FtsK; Provisional; Region:
                     PRK10263"
                     /db_xref="CDD:236669"
ORIGIN      

atggacaccccctcatacccacggacaccccttggtacccatgcacaccccgtcatagccacggacaccccttggtacccatggacaccccctcatacccacggacactccttggtaccctctgagcaccccctcacacccacggacaccccttggtacccacggaccccagcaccccctcatacccacggacaccccttggaccctcgagcaccctctcatacccacggacaccccttggtaccctctgagcaccccctcatacccacggacacccttgcaccccctcatacccacggacaccccttggtacccacggacaccctcgagcaccctctcatacccacggacaccccttggtaccctctgagcaccccctcatacccacggacaccccttggtacccacggacaccctcgagcaccctctcatacccacggacaccccttggtaccctctgagcaccccctcatacccacggacaccccttggtacccacggacaccctcgagcaccccctcatacccacgaacactcccgggcacctcctag

//