GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-09 22:37:55, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_069625348             690 bp    mRNA    linear   VRT 15-NOV-2024
DEFINITION  PREDICTED: Ambystoma mexicanum cysteine-rich, acidic integral
            membrane protein-like (LOC138504982), mRNA.
ACCESSION   XM_069625348
VERSION     XM_069625348.1
DBLINK      BioProject: PRJNA1165261
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Ambystoma mexicanum (axolotl)
  ORGANISM  Ambystoma mexicanum
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Caudata; Salamandroidea; Ambystomatidae;
            Ambystoma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_090934) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_040938575.1-RS_2024_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/03/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..690
                     /organism="Ambystoma mexicanum"
                     /mol_type="mRNA"
                     /isolate="Mex_15411"
                     /db_xref="taxon:8296"
                     /chromosome="11"
                     /sex="female"
                     /tissue_type="tail tip"
                     /geo_loc_name="USA: Kentucky, University of Kentucky"
                     /collection_date="2023-02"
     gene            1..690
                     /gene="LOC138504982"
                     /note="cysteine-rich, acidic integral membrane
                     protein-like; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:138504982"
     CDS             1..690
                     /gene="LOC138504982"
                     /codon_start=1
                     /product="cysteine-rich, acidic integral membrane
                     protein-like"
                     /protein_id="XP_069481449.1"
                     /db_xref="GeneID:138504982"
                     /translation="
MDETDGVDATDGVDETDGVDETDGVDETDGVDETDGVDETDGVDETDGVDETDGVDETDGVGGKDEVDGTNEVDGTDEVDETDEVDETEEVNKMDEVNETDEVNETDEMDGTDEVDGTDEVDGTDEVDETDEVDETEEVNKTDEVNETDEMDGTDEVDGTDEVDGTDEVDEMEEVNKTDEVNEPDEVDRTDKVDEMDEVDKTDEVDRTDEADGTDEADGTDEAERMKWM"
     misc_feature    <22..>672
                     /gene="LOC138504982"
                     /note="K+-dependent Na+/Ca+ exchanger; Region: 2A1904;
                     TIGR00927"
                     /db_xref="CDD:273344"
ORIGIN      
atggatgaaacggatggagtagatgcaactgatggagtagatgaaactgatggagtagatgaaactgatggagtagatgaaaccgatggagtagatgaaaccgatggagtagatgaaaccgatggagtagatgaaaccgatggagtagatgaaaccgatggagtagatgaaaccgatggagtaggtggaaaggatgaagtagatggaactaatgaagtggatggaactgatgaagtggatgaaactgatgaagtggatgaaacggaagaagtaaataaaatggatgaagtgaatgaaacagatgaagtgaatgaaacagatgaaatggatggaacagatgaagtggatggaacggatgaagtggatggaactgatgaagtagatgaaactgatgaagtggatgaaacggaagaagtaaataaaacggatgaagtgaatgaaacagatgaaatggatggaacagatgaagtggatggaacggatgaagtggatggaactgatgaagtagatgaaatggaagaagtaaataaaacggatgaagtgaatgaaccagatgaagtggacagaacggacaaagtggatgaaatggacgaagtggataaaactgatgaagtggatagaacggatgaagcggatggaacggatgaagcggatggaacggatgaagctgaacggatgaagtggatgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]