2025-08-20 17:57:21, GGRNA.v2 : RefSeq release 230 (May, 2025)
LOCUS XM_069375334 1364 bp mRNA linear PLN 23-OCT-2024 DEFINITION Cladosporium halotolerans uncharacterized protein (WHR41_06729), mRNA. ACCESSION XM_069375334 VERSION XM_069375334.1 DBLINK BioProject: PRJNA1175685 BioSample: SAMN14329494 KEYWORDS RefSeq. SOURCE Cladosporium halotolerans ORGANISM Cladosporium halotolerans Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Dothideomycetidae; Cladosporiales; Cladosporiaceae; Cladosporium. REFERENCE 1 (bases 1 to 1364) AUTHORS Gioti,A., Siaperas,R., Nikolaivits,E., Le Goff,G., Ouazzani,J., Kotoulas,G. and Topakas,E. TITLE Draft Genome Sequence of a Cladosporium Species Isolated from the Mesophotic Ascidian Didemnum maculosum JOURNAL Microbiol Resour Announc 9 (18), e00311-20 (2020) PUBMED 32354980 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1364) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-OCT-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1364) AUTHORS Siaperas,R., Gioti,A., Topakas,E. and Kotoulas,G. TITLE Direct Submission JOURNAL Submitted (22-MAR-2024) IndBioCat, School of Chemical Engineering, National Technical University of Athens (NTUA), 9 Iroon Polytechniou str., Athens 15772, Greece REFERENCE 4 (bases 1 to 1364) AUTHORS Gioti,A., Siaperas,R., Nikolaivits,E., Le Goff,G., Ouazzani,J., Kotoulas,G. and Topakas,E. TITLE Direct Submission JOURNAL Submitted (16-MAR-2020) Genetics, Hellenic Centre of Marine Research (HCMR), Proin Amerikaniki Vassi, P.O. Box 2214, Gournes, Heraklion, Crete 71500, Greece COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_027191478). FEATURES Location/Qualifiers source 1..1364 /organism="Cladosporium halotolerans" /mol_type="mRNA" /strain="TM138-S3" /isolation_source="rock from coastal sea water" /host="Didemnum maculosum" /db_xref="taxon:1052096" /chromosome="Unknown" /geo_loc_name="Spain:Granada" /lat_lon="36.719250 N 3.727528 W" /collection_date="2017-03-05/2017-03-25" gene 1..1364 /locus_tag="WHR41_06729" /db_xref="GeneID:96008172" CDS 51..1136 /locus_tag="WHR41_06729" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069227378.1" /db_xref="CDD:cd02998" /db_xref="GeneID:96008172" /db_xref="GO:0005783" /db_xref="InterPro:IPR011679" /db_xref="InterPro:IPR013766" /db_xref="PFAM:PF00085" /db_xref="PFAM:PF07749" /translation="
MVRIPSFFTAALALTGASASAVKDLLPGNFDEVVLKSGKPALVEFFAPWCGHCKTLAPVYEELAAAFEHADDKVTIAKVDADAHKELGRKWGVQGFPTLKWFDGKSDKPEDYKSGRDLESLSAFVTSKTGVKTKAKKAAPSAVEMLTDTTFKEKIGAGQDALVAFTAPWCGHCKSLAPTWEKLATDFAQESGVLVAKVDCEAPNAKATAQEAGVKSYPTIKYYPAGSSEAVPYTGGRSEADLVAFLNDKAGTQRTVGGGLSALAGTIPSLDEIVRSLRSGGEKAQAELEKAAAAAKDSYADYYSKVAKKSEENAGYVEKELTRLQNLLKKGGLTADKMDDLMKRSNILNVFKGSEGGKDEL"
misc_feature 111..425 /locus_tag="WHR41_06729" /note="PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain...; Region: PDI_a_ERp38; cd02998" /db_xref="CDD:239296" misc_feature order(198..200,207..209,396..398) /locus_tag="WHR41_06729" /note="catalytic residues [active]" /db_xref="CDD:239296" misc_feature 474..788 /locus_tag="WHR41_06729" /note="The thioredoxin (TRX)-like superfamily is a large, diverse group of proteins containing a TRX fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox...; Region: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; cl00388" /db_xref="CDD:469754" misc_feature 843..1103 /locus_tag="WHR41_06729" /note="Endoplasmic reticulum protein ERp29, C-terminal domain; Region: ERp29; pfam07749" /db_xref="CDD:462253" ORIGIN
gacagcaactcttctccaccacccatcccaaacctggaaacacaacaaccatggtccggattccctccttcttcacagcggctctggctctcacaggcgcctccgcctcggcggtcaaagatctgctgccgggcaacttcgacgaagtcgtgctcaagtccggcaagcccgcgctggtcgagttcttcgcgccgtggtgcggacactgcaagacgctggcgcccgtgtacgaggagctggcggcggccttcgagcacgccgacgacaaggtcaccatcgccaaggtcgatgccgatgcgcacaaggagctcggccgcaagtggggagtgcagggcttcccgaccctcaagtggttcgatggcaagtccgataagcccgaggactacaagagtgggcgtgatttggagagcttgagcgcatttgttacgtccaaaaccggtgtgaagaccaaggcgaagaaggcggcgcccagcgctgtggagatgttgacggataccacgttcaaggagaagattggcgctggacaggatgcgctcgttgcgttcactgcgccttggtgtggccactgcaaatccctcgccccgacctgggagaagctcgcgaccgacttcgcacaggagtccggcgtgctcgtcgctaaagtcgactgcgaggcccccaatgccaaagccaccgcgcaggaagccggtgtcaagtcctaccctacgatcaagtactaccccgctggctccagcgaagcggtgccctacaccggcggccgcagcgaggctgatctcgtggcattcctaaacgacaaggccggcactcagcgtaccgtcggtggcggtctgtccgcgctcgcaggcacgatcccgtccctggacgagatcgttcgctcgctgcgcagcggtggcgagaaggcgcaggcagagcttgagaaggctgctgctgcggccaaggatagctacgcggactactacagcaaggtcgcgaagaagagcgaggagaacgccggatacgtcgagaaggagttgactaggctgcagaacctgctgaagaagggtggcctcacggctgacaagatggacgatctgatgaagaggagcaacatcctcaatgtcttcaagggctctgagggcggtaaggacgagctctagaggagttctcatgagaattgaattgtggaatggctattattatggcctaagacgaaaagcacatcatcaaagactacggcaaaagctggtcttgtaagataattgcaatcatgattgcattgatagattacatcacaaagtccagtgtacaagcatctcgtatcatgcattgtattcatgtacaagtcgaaccatggtatcaagccagatggcttctacggttgctat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]