GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-10-05 16:46:16, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_067211504             375 bp    mRNA    linear   INV 12-AUG-2024
DEFINITION  Cryptosporidium andersoni prefoldin subunit 2 (cand_012670),
            partial mRNA.
ACCESSION   XM_067211504
VERSION     XM_067211504.1
DBLINK      BioProject: PRJNA354069
            BioSample: SAMN04417240
KEYWORDS    RefSeq.
SOURCE      Cryptosporidium andersoni
  ORGANISM  Cryptosporidium andersoni
            Eukaryota; Sar; Alveolata; Apicomplexa; Conoidasida; Coccidia;
            Eucoccidiorida; Eimeriorina; Cryptosporidiidae; Cryptosporidium.
REFERENCE   1  (bases 1 to 375)
  AUTHORS   Liu,S., Roellig,D.M., Guo,Y., Li,N., Frace,M.A., Tang,K., Zhang,L.,
            Feng,Y. and Xiao,L.
  TITLE     Reductive evolution of mitochondrial metabolism and differential
            evolution of invasion-related proteins in Cryptosporidium
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 375)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 375)
  AUTHORS   Xiao,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-OCT-2016) Division of Foodborne, Waterborne and
            Environmental Diseases, Centers for Disease Control and Prevention,
            1600 Clifton Road NE, Atlanta, GA 30329-4018, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_027122903).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..375
                     /organism="Cryptosporidium andersoni"
                     /mol_type="mRNA"
                     /isolate="30847"
                     /host="cattle"
                     /db_xref="taxon:117008"
                     /chromosome="Unknown"
                     /dev_stage="oocysts"
                     /geo_loc_name="Canada: Alberta"
                     /collection_date="2009-06"
     gene            <1..>375
                     /locus_tag="cand_012670"
                     /db_xref="GeneID:92365452"
     CDS             1..375
                     /locus_tag="cand_012670"
                     /codon_start=1
                     /product="prefoldin subunit 2"
                     /protein_id="XP_067066912.1"
                     /db_xref="GeneID:92365452"
                     /translation="
MVETGYTKETQEEIVQLDKKLKLLNNKISELTQDSKEYGLVLNAFEKVDENRRCFRVIGGVMVERNVKTVKPALEKEKSALDSAISELEKQYESTEKEMKNLIEKYSTNSADHAQITSSSSSQQ"
     misc_feature    25..318
                     /locus_tag="cand_012670"
                     /note="prefoldin subunit 2; Region: Prefoldin_2; cd23163"
                     /db_xref="CDD:467479"
     misc_feature    25..144
                     /locus_tag="cand_012670"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:467479"
     misc_feature    order(28..30,40..42,49..54,61..66,70..75,82..87,94..96,
                     256..258,265..267,277..279,289..291,298..303,310..315)
                     /locus_tag="cand_012670"
                     /note="prefoldin beta subunit /TRiC interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:467479"
     misc_feature    order(121..123,130..132,142..147,154..174,178..195,
                     205..210,220..222)
                     /locus_tag="cand_012670"
                     /note="prefoldin oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:467479"
     misc_feature    202..318
                     /locus_tag="cand_012670"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:467479"
ORIGIN      
atggttgagacaggatatactaaggagacacaagaagagattgttcaactagataagaagctcaaactactaaacaataagatttcagagcttactcaagatagtaaagagtatggtctagtcttaaatgcatttgagaaggtagacgagaaccgacgatgctttagagttattggtggtgtgatggttgagagaaatgttaaaactgttaaacctgctcttgaaaaagaaaagagtgcgttagatagtgcaatttccgaattagagaaacagtatgaatctactgaaaaggaaatgaagaatctaattgagaagtatagtacaaacagtgctgaccatgcacaaataactagttcatcaagctcgcaacaataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]