LOCUS       XM_066131504             204 bp    mRNA    linear   PLN 26-JUN-2024
DEFINITION  Metarhizium brunneum uncharacterized protein (G6M90_00g096120),
            partial mRNA.
ACCESSION   XM_066131504
VERSION     XM_066131504.1
DBLINK      BioProject: PRJNA1128270
            BioSample: SAMN15394350
KEYWORDS    RefSeq.
SOURCE      Metarhizium brunneum
  ORGANISM  Metarhizium brunneum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae;
            Metarhizium.
REFERENCE   1  (bases 1 to 204)
  AUTHORS   Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M.
  TITLE     Telomere length de novo assembly of all 7 chromosomes of the
            fungus, Metarhizium brunneum, using a novel assembly pipeline
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 204)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 204)
  AUTHORS   Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2020) Biocontrol and Natural Products Group
            (BANP), Biological Sciences, Swansea University, Singleton Park
            Campus, Swansea SA28PP, United Kingdom
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_089427).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..204
                     /organism="Metarhizium brunneum"
                     /mol_type="mRNA"
                     /strain="4556"
                     /host="Boophilus sp. [Acari: Ixodidae]"
                     /db_xref="taxon:500148"
                     /chromosome="6"
                     /geo_loc_name="USA: Florida"
                     /collection_date="29-Sep-1993"
     gene            <1..>204
                     /locus_tag="G6M90_00g096120"
                     /db_xref="GeneID:90968155"
     CDS             1..204
                     /locus_tag="G6M90_00g096120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_065987771.1"
                     /db_xref="GeneID:90968155"
                     /db_xref="GO:0005783"
                     /db_xref="InterPro:IPR010580"
                     /db_xref="PFAM:PF06624"
                     /translation="

MAQTLEQRRRNAKFAKEQEARMGKSDDQIKKRAKETPKSPISPVWIGVLGFIVFGGLLFEALSRMFA"

     misc_feature    4..180
                     /locus_tag="G6M90_00g096120"
                     /note="Ribosome associated membrane protein RAMP4; Region:
                     RAMP4; pfam06624"
                     /db_xref="CDD:461965"
ORIGIN      

atggcccaaactctcgagcagcgccgccgaaacgcaaagttcgccaaggagcaggaggctcgcatgggcaagtcagacgaccagatcaagaagcgcgccaaggagacgcccaagtctcccatctcgcccgtctggatcggtgtcctcggtttcatcgtcttcggcggcctgctattcgaggccctgtcccgcatgttcgcatag

//