LOCUS       XM_065839315            1723 bp    mRNA    linear   VRT 04-MAR-2025
DEFINITION  PREDICTED: Patagioenas fasciata dicer 1, ribonuclease III (DICER1),
            transcript variant X8, mRNA.
ACCESSION   XM_065839315
VERSION     XM_065839315.2
DBLINK      BioProject: PRJNA1228574
KEYWORDS    RefSeq.
SOURCE      Patagioenas fasciata (band-tailed pigeon)
  ORGANISM  Patagioenas fasciata
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Columbimorphae;
            Columbiformes; Columbidae; Patagioenas.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_092524) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Mar 4, 2025 this sequence version replaced XM_065839315.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_037038585.1-RS_2025_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/28/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1723
                     /organism="Patagioenas fasciata"
                     /mol_type="mRNA"
                     /isolate="bPatFas1"
                     /db_xref="taxon:372321"
                     /chromosome="5"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /geo_loc_name="USA: Massapequa, NY"
                     /collection_date="2022-08-25"
     gene            1..1723
                     /gene="DICER1"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:136102328"
     CDS             344..1723
                     /gene="DICER1"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X2"
                     /protein_id="XP_065695387.1"
                     /db_xref="GeneID:136102328"
                     /translation="

MKSPALQSLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNKNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSSLEVTESWTKEKWSQEFSKHQVLVMTCHVALTVLRNEYLSLSNINLLVFDECHLAIQDHAYREIMKICEGYPSCPRILGLTASILNGKCDPAELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPYTDKSGLYGRLLKELDEALTFLNDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"

     misc_feature    467..1060
                     /gene="DICER1"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(467..478,485..487,536..559,680..682,869..871,
                     962..964)
                     /gene="DICER1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(644..649,716..721,794..796,800..805,812..814,
                     887..895)
                     /gene="DICER1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1160..1438
                     /gene="DICER1"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(1169..1174,1181..1183,1187..1192,1367..1372,
                     1379..1384,1391..1393,1400..1405,1412..1414)
                     /gene="DICER1"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    1457..>1720
                     /gene="DICER1"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      

gaatggaggaacctgacagttggggggagtgaggcgacggcggcggggaaatggcggcggcagcagcagcacaatgagacgcggcctgtagtggggggaagcgtcaggctgagtcccgtccgagcaggttacctagggtgaaacaaaattacaggcttggagactctggaaaagctcagcatcagcatttgagaggcgaagcttgcaaattatgtgattaatctacaagctgatatcatgatgtcaaaatgcagttcgggaagcataaacacagagactgcggaaattaaaacgtaggctgtgctggaacaaaaatgcaatgaaagaaacactggatgaatgaatgaaaagccctgctttgcaatccctcagcatggcgggactgcagcttatgacccctgcttcctccccaatgggtccattttttggactgccatggcaacaagaagcaattcacgataacatttacacgccaagaaaatatcaggttgaactgcttgaagcagctttggatcataatacaatagtctgcttaaacactggctcagggaagacttttattgcagtactactcactaaagagctgtcctatcagatcaggggagatttcaacaaaaatggaaaaagaactgtgttcttggtcaactcagcaaatcaagttgctcaacaagtgtcagctgtcaggacacattcagatcttaaagtgggagagtattcaagtttagaggtaactgaatcatggacaaaagagaagtggagtcaggaattctctaagcatcaggttctggttatgacatgtcatgttgctttgactgttttgagaaatgaatatttatccctgtcaaatattaatcttctggtgtttgatgagtgccatcttgcaatccaggatcatgcataccgtgaaattatgaagatctgtgagggttacccatcatgtcctcgaatcttgggattaacagcttccattttaaatgggaagtgtgatcctgctgagttagaagagaagatccagaaactggagaagattttgaagagcaatgctgaaactgcaactgatttggtggtcttagacagatatacttctcagccgtgtgagattgttgtagactgtggaccatatactgacaaaagtgggttgtatggaagattactgaaggagctggatgaagcacttacttttctaaatgactgcaacatatctgtacattcaaaagaaagagattctaccttaatttctaagcagatattatcagactgtcgagctgtgttggttgttctgggaccctggtgtgcagataaggtagctgggatgatggtgagagagctacagaagtatatcaaacacgaacaagaggagctgcacaggaaatttttattgtttacagacactttcctaaggaaaatacatgcactctgtgaagagcatttctcgcctgcctcacttgacctgaaatttgtaacccctaaagtaataaagctgcttgaaatcttgcgcaaatataaaccatatgaacggcagcagtttgaaagtgttgaatggtataacaatagaaatcaggataattatgtatcttggagtgattctgaagatgatgatgaggatgaagaaattgaggagaaagagaagccagagactaatttcccatctccctttactaatattttatgtggaattatttttgtggaaagaagatacacagcagttgttctaaataggtaa

//