GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-10-06 00:37:24, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_065211350             989 bp    mRNA    linear   INV 10-MAY-2024
DEFINITION  PREDICTED: Rhopilema esculentum splicing regulatory
            glutamine/lysine-rich protein 1-like (LOC135692994), partial mRNA.
ACCESSION   XM_065211350
VERSION     XM_065211350.1
DBLINK      BioProject: PRJNA1104281
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Rhopilema esculentum
  ORGANISM  Rhopilema esculentum
            Eukaryota; Metazoa; Cnidaria; Scyphozoa; Rhizostomeae;
            Rhizostomatidae; Rhopilema.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027019844) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_013076305.1-RS_2024_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/29/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..989
                     /organism="Rhopilema esculentum"
                     /mol_type="mRNA"
                     /isolate="edhc-2017"
                     /db_xref="taxon:499914"
                     /chromosome="Unknown"
                     /tissue_type="whole body"
                     /geo_loc_name="China: South China Sea"
                     /collection_date="2019"
     gene            1..>989
                     /gene="LOC135692994"
                     /note="splicing regulatory glutamine/lysine-rich protein
                     1-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:135692994"
     CDS             1..>989
                     /gene="LOC135692994"
                     /codon_start=1
                     /product="splicing regulatory glutamine/lysine-rich
                     protein 1-like"
                     /protein_id="XP_065067422.1"
                     /db_xref="GeneID:135692994"
                     /translation="
MQKHPGVLSNKTLMKQATHTNNNREEGNTNKDGDRKSFAQRIQQTRFHGTETARRTLRIETDERPIKGADNPRLLRRRQKELRSKDPTNQVSWNRDGKKDFENRDGRAADHRSGQPSSIETETERASLKGSSKPGSRKQRRQEGLSWIETDVLPIKGAGKPRLLRRRQKELRSKDPANQVSRNRDGKKDFVDRDGRAVDQRGGQPSSIETETERASLKGSNKPGFMEQRRIQKTRFQGTETARRTLRIETDERPIKGAGNPRLLRRRQKELLSKDPANQVSRNRDGKKDFVDRDGRAVDQRSGQPSSIETETERASLKGSNKPGFKEQRR"
ORIGIN      
atgcaaaagcacccaggagttctatcaaacaagaccttgatgaaacaagcgactcacacaaacaacaatcgagaagaagggaatacaaacaaagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcatggaacagagacggcaagaaggactttgagaatagagacggacgagcggccgatcaaaggagcggacaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcatggaacagagacggcaagaaggactttgagaatagagacggacgagcggccgatcacaggagcgggcaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccagcaaaccaggttcaaggaaacagagacggcaagaaggactttcgtggatagagacggacgtgctgccgatcaaaggagcgggcaaacctcgtctattgagacggagacagaaagagcttcgctcaaaggatccagcaaaccaggtttcaaggaacagagacggcaagaaggactttgtggatagagacggacgtgctgtcgatcaaaggggcgggcaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcatggaacagagacggatccagaaaaccaggtttcaaggaacagagacggcaagaaggactttgagaatagagacggacgagcggccgatcaaaggagcgggcaaccctcgtctattgagacggagacagaaagagcttctctcaaaggatccagcaaaccaggtttcaaggaacagagacggcaagaaggactttgtggatagagacggacgtgctgtcgatcaaaggagcgggcaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcaaggaacagagacg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]